Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 145617..146497 | Replicon | plasmid pB |
| Accession | NZ_CP097482 | ||
| Organism | Chroococcidiopsis sp. CCNUC1 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M5J74_RS31640 | Protein ID | WP_250017679.1 |
| Coordinates | 146015..146497 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M5J74_RS31635 | Protein ID | WP_250017678.1 |
| Coordinates | 145617..145976 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5J74_RS31590 (M5J74_31590) | 140660..140911 | + | 252 | WP_106168121.1 | hypothetical protein | - |
| M5J74_RS31595 (M5J74_31595) | 141023..141322 | + | 300 | WP_250017995.1 | hypothetical protein | - |
| M5J74_RS31600 (M5J74_31600) | 141467..141628 | + | 162 | WP_158631951.1 | hypothetical protein | - |
| M5J74_RS31605 (M5J74_31605) | 141614..142036 | - | 423 | WP_250017672.1 | type II toxin-antitoxin system VapC family toxin | - |
| M5J74_RS31610 (M5J74_31610) | 142036..142281 | - | 246 | WP_250017673.1 | Arc family DNA-binding protein | - |
| M5J74_RS31615 (M5J74_31615) | 142496..143239 | - | 744 | WP_250017674.1 | hypothetical protein | - |
| M5J74_RS31620 (M5J74_31620) | 143244..143801 | - | 558 | WP_250017675.1 | hypothetical protein | - |
| M5J74_RS31625 (M5J74_31625) | 143765..144550 | - | 786 | WP_250017676.1 | DUF4058 family protein | - |
| M5J74_RS31630 (M5J74_31630) | 144743..145516 | + | 774 | WP_250017677.1 | Uma2 family endonuclease | - |
| M5J74_RS31635 (M5J74_31635) | 145617..145976 | + | 360 | WP_250017678.1 | DUF2384 domain-containing protein | Antitoxin |
| M5J74_RS31640 (M5J74_31640) | 146015..146497 | + | 483 | WP_250017679.1 | RES domain-containing protein | Toxin |
| M5J74_RS31645 (M5J74_31645) | 146507..146788 | + | 282 | WP_250017680.1 | hypothetical protein | - |
| M5J74_RS31650 (M5J74_31650) | 146802..147848 | + | 1047 | WP_250018015.1 | site-specific integrase | - |
| M5J74_RS31655 (M5J74_31655) | 148224..149348 | + | 1125 | WP_250017682.1 | site-2 protease family protein | - |
| M5J74_RS31660 (M5J74_31660) | 149941..150231 | - | 291 | WP_250017684.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..283128 | 283128 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 18192.58 Da Isoelectric Point: 4.9679
>T245503 WP_250017679.1 NZ_CP097482:146015-146497 [Chroococcidiopsis sp. CCNUC1]
MLAPKWAYQPLSGAGAARHGGRFNEPGQEALYISEDYITAISEYEQELGIRPGTLCAYDVDVKGIVDLTDPQVQTICSVS
PDILKYPWKEIWLISKQRPPTWDLASRLIAENYAGIRVPSVRHLDGINIVLWRWNDCENRRIRALDPRQDLPTDQSSWNA
MLAPKWAYQPLSGAGAARHGGRFNEPGQEALYISEDYITAISEYEQELGIRPGTLCAYDVDVKGIVDLTDPQVQTICSVS
PDILKYPWKEIWLISKQRPPTWDLASRLIAENYAGIRVPSVRHLDGINIVLWRWNDCENRRIRALDPRQDLPTDQSSWNA
Download Length: 483 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13217.29 Da Isoelectric Point: 6.9231
>AT245503 WP_250017678.1 NZ_CP097482:145617-145976 [Chroococcidiopsis sp. CCNUC1]
MLSPFLAEVMEPHKGIISPHLLSQMLHISLARLSELTQLHRNTLTRHPESPEVQQRLGEIARIVTVAAELVGDRTRAIVW
FRHQPLSGFDNKTAEELVAAGHAKAVLEHLAMLSDGVYA
MLSPFLAEVMEPHKGIISPHLLSQMLHISLARLSELTQLHRNTLTRHPESPEVQQRLGEIARIVTVAAELVGDRTRAIVW
FRHQPLSGFDNKTAEELVAAGHAKAVLEHLAMLSDGVYA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|