Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 4410548..4411028 Replicon chromosome
Accession NZ_CP097480
Organism Chroococcidiopsis sp. CCNUC1

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag M5J74_RS20240 Protein ID WP_250012977.1
Coordinates 4410765..4411028 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag M5J74_RS20235 Protein ID WP_250012976.1
Coordinates 4410548..4410778 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5J74_RS20215 (M5J74_20215) 4405660..4405878 + 219 WP_250012973.1 hypothetical protein -
M5J74_RS20220 (M5J74_20220) 4405882..4406166 + 285 WP_015155588.1 type II toxin-antitoxin system YafQ family toxin -
M5J74_RS20225 (M5J74_20225) 4406160..4409384 - 3225 WP_250012974.1 N-6 DNA methylase -
M5J74_RS20230 (M5J74_20230) 4409473..4409715 - 243 WP_250012975.1 helix-turn-helix transcriptional regulator -
M5J74_RS20235 (M5J74_20235) 4410548..4410778 - 231 WP_250012976.1 BrnA antitoxin family protein Antitoxin
M5J74_RS20240 (M5J74_20240) 4410765..4411028 - 264 WP_250012977.1 BrnT family toxin Toxin
M5J74_RS20245 (M5J74_20245) 4411352..4411606 + 255 WP_250012978.1 YlcI/YnfO family protein -
M5J74_RS20250 (M5J74_20250) 4411599..4412021 + 423 WP_250012979.1 type II toxin-antitoxin system VapC family toxin -
M5J74_RS20255 (M5J74_20255) 4412085..4412258 - 174 WP_250012980.1 hypothetical protein -
M5J74_RS20260 (M5J74_20260) 4412242..4412970 - 729 WP_250012981.1 AAA family ATPase -
M5J74_RS20265 (M5J74_20265) 4413367..4413951 + 585 WP_250012982.1 alpha/beta hydrolase -
M5J74_RS20270 (M5J74_20270) 4414357..4414866 + 510 WP_250012983.1 DUF411 domain-containing protein -
M5J74_RS32860 4414978..4415100 - 123 WP_256498546.1 hypothetical protein -
M5J74_RS20275 (M5J74_20275) 4415149..4415892 + 744 WP_250012984.1 aldo/keto reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(5-80)

Antitoxin

CopG antitoxin

(7-68)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10427.72 Da        Isoelectric Point: 5.2435

>T245502 WP_250012977.1 NZ_CP097480:c4411028-4410765 [Chroococcidiopsis sp. CCNUC1]
MEFEFDETKSQSNREKHGIDFVEAQELWEDSQRLEIPARTEDEPRYLVIGKIGDKHWSAVITYRNVKIRIISVRRARQEE
MAIYESK

Download         Length: 264 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8921.23 Da        Isoelectric Point: 8.0135

>AT245502 WP_250012976.1 NZ_CP097480:c4410778-4410548 [Chroococcidiopsis sp. CCNUC1]
MKASEFDQKFDKGEDISEFLDLAAARRPGYEQKRVNVDFPAWMIEALDREAKRLGVTRQSIVKVWIAERLEKCPHR

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References