Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazE-MazF |
Location | 3823631..3824211 | Replicon | chromosome |
Accession | NZ_CP097480 | ||
Organism | Chroococcidiopsis sp. CCNUC1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K9U3S3 |
Locus tag | M5J74_RS17845 | Protein ID | WP_015155424.1 |
Coordinates | 3823631..3823891 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M5J74_RS17850 | Protein ID | WP_181246392.1 |
Coordinates | 3823885..3824211 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J74_RS17815 (M5J74_17815) | 3818775..3819518 | + | 744 | WP_106167415.1 | phycobilisome rod-core linker polypeptide | - |
M5J74_RS17820 (M5J74_17820) | 3819739..3820500 | + | 762 | WP_015155419.1 | phycobilisome rod-core linker polypeptide | - |
M5J74_RS17825 (M5J74_17825) | 3820728..3821201 | + | 474 | WP_106168164.1 | hypothetical protein | - |
M5J74_RS17830 (M5J74_17830) | 3821315..3822187 | - | 873 | WP_250012641.1 | NAD(P)-dependent oxidoreductase | - |
M5J74_RS17835 (M5J74_17835) | 3822479..3822886 | + | 408 | WP_106168163.1 | 50S ribosomal protein L21 | - |
M5J74_RS17840 (M5J74_17840) | 3822983..3823270 | + | 288 | WP_015155423.1 | 50S ribosomal protein L27 | - |
M5J74_RS17845 (M5J74_17845) | 3823631..3823891 | + | 261 | WP_015155424.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Toxin |
M5J74_RS17850 (M5J74_17850) | 3823885..3824211 | + | 327 | WP_181246392.1 | type II toxin-antitoxin system PemK/MazF family toxin | Antitoxin |
M5J74_RS17855 (M5J74_17855) | 3824214..3825188 | + | 975 | WP_250012642.1 | XdhC family protein | - |
M5J74_RS17860 (M5J74_17860) | 3825233..3826195 | - | 963 | WP_250012643.1 | DUF6263 family protein | - |
M5J74_RS17865 (M5J74_17865) | 3826404..3826970 | + | 567 | WP_250012644.1 | hypothetical protein | - |
M5J74_RS17870 (M5J74_17870) | 3826981..3827517 | - | 537 | WP_250012645.1 | bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR | - |
M5J74_RS17875 (M5J74_17875) | 3827518..3827748 | + | 231 | WP_250012646.1 | hypothetical protein | - |
M5J74_RS17880 (M5J74_17880) | 3827790..3829076 | - | 1287 | WP_015155430.1 | aminopeptidase P N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 9841.17 Da Isoelectric Point: 4.4992
>T245500 WP_015155424.1 NZ_CP097480:3823631-3823891 [Chroococcidiopsis sp. CCNUC1]
MGTGIRTRIVRIGNSQGIRIPKPLLEQSGIDTEVEIEVQDECLIVRAASRSRIGWDKAFAAMAEQKDDVLLDDVNITEWD
RTEWKW
MGTGIRTRIVRIGNSQGIRIPKPLLEQSGIDTEVEIEVQDECLIVRAASRSRIGWDKAFAAMAEQKDDVLLDDVNITEWD
RTEWKW
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|