Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 3788634..3789196 Replicon chromosome
Accession NZ_CP097480
Organism Chroococcidiopsis sp. CCNUC1

Toxin (Protein)


Gene name mazF Uniprot ID K9U349
Locus tag M5J74_RS17645 Protein ID WP_015155386.1
Coordinates 3788864..3789196 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID K9U1Z6
Locus tag M5J74_RS17640 Protein ID WP_015155385.1
Coordinates 3788634..3788870 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5J74_RS17600 (M5J74_17600) 3783817..3784008 + 192 WP_015155377.1 hypothetical protein -
M5J74_RS17605 (M5J74_17605) 3784115..3784939 + 825 WP_250012627.1 cobalt-precorrin-6A reductase -
M5J74_RS32790 3785184..3785318 + 135 WP_256498205.1 hypothetical protein -
M5J74_RS17610 (M5J74_17610) 3785471..3786085 - 615 WP_250012628.1 2OG-Fe(II) oxygenase -
M5J74_RS17615 (M5J74_17615) 3786179..3786604 - 426 WP_015155381.1 PIN domain-containing protein -
M5J74_RS17620 (M5J74_17620) 3786601..3786861 - 261 WP_015155382.1 hypothetical protein -
M5J74_RS17625 (M5J74_17625) 3787143..3787322 + 180 WP_250012629.1 hypothetical protein -
M5J74_RS17630 (M5J74_17630) 3787476..3787670 + 195 WP_015155383.1 heavy-metal-associated domain-containing protein -
M5J74_RS17635 (M5J74_17635) 3787648..3788553 - 906 WP_015155384.1 alpha/beta hydrolase -
M5J74_RS17640 (M5J74_17640) 3788634..3788870 + 237 WP_015155385.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
M5J74_RS17645 (M5J74_17645) 3788864..3789196 + 333 WP_015155386.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M5J74_RS17650 (M5J74_17650) 3789254..3789466 + 213 WP_015155387.1 type II toxin-antitoxin system VapB family antitoxin -
M5J74_RS17655 (M5J74_17655) 3789453..3789854 + 402 WP_015155388.1 PIN domain nuclease -
M5J74_RS17660 (M5J74_17660) 3789924..3790898 + 975 WP_250012630.1 tyrosine-type recombinase/integrase -
M5J74_RS17665 (M5J74_17665) 3790974..3792125 - 1152 WP_250012631.1 tyrosine-type recombinase/integrase -
M5J74_RS17670 (M5J74_17670) 3792524..3793108 + 585 WP_015155391.1 DUF99 family protein -
M5J74_RS17675 (M5J74_17675) 3793242..3793577 - 336 WP_250012632.1 hypothetical protein -
M5J74_RS17680 (M5J74_17680) 3793580..3793825 - 246 WP_250012633.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-108)

Antitoxin

Antitoxin PemI-like

(1-78)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12562.72 Da        Isoelectric Point: 9.3549

>T245499 WP_015155386.1 NZ_CP097480:3788864-3789196 [Chroococcidiopsis sp. CCNUC1]
VVEVPARGTFIWLNFEPQSGREQMGRRPALVVSHTAFNRKRGFAFVCPISNTRRKNPFYIAIPEGLAVTGVIMCDQLRSL
DYRIRNAEFLGECPISLLEEVLLRIQPIFL

Download         Length: 333 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 9121.44 Da        Isoelectric Point: 4.9155

>AT245499 WP_015155385.1 NZ_CP097480:3788634-3788870 [Chroococcidiopsis sp. CCNUC1]
MRSSIGKWGNSLGLRIPRHIVEELSLHPNDEVECRVEKGRLIVEVVHKRKYTLEELLSQEMEPEPEIDWGKPMGEEAW

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB K9U349

Antitoxin

Source ID Structure
AlphaFold DB K9U1Z6

References