Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3788634..3789196 | Replicon | chromosome |
| Accession | NZ_CP097480 | ||
| Organism | Chroococcidiopsis sp. CCNUC1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | K9U349 |
| Locus tag | M5J74_RS17645 | Protein ID | WP_015155386.1 |
| Coordinates | 3788864..3789196 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | K9U1Z6 |
| Locus tag | M5J74_RS17640 | Protein ID | WP_015155385.1 |
| Coordinates | 3788634..3788870 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5J74_RS17600 (M5J74_17600) | 3783817..3784008 | + | 192 | WP_015155377.1 | hypothetical protein | - |
| M5J74_RS17605 (M5J74_17605) | 3784115..3784939 | + | 825 | WP_250012627.1 | cobalt-precorrin-6A reductase | - |
| M5J74_RS32790 | 3785184..3785318 | + | 135 | WP_256498205.1 | hypothetical protein | - |
| M5J74_RS17610 (M5J74_17610) | 3785471..3786085 | - | 615 | WP_250012628.1 | 2OG-Fe(II) oxygenase | - |
| M5J74_RS17615 (M5J74_17615) | 3786179..3786604 | - | 426 | WP_015155381.1 | PIN domain-containing protein | - |
| M5J74_RS17620 (M5J74_17620) | 3786601..3786861 | - | 261 | WP_015155382.1 | hypothetical protein | - |
| M5J74_RS17625 (M5J74_17625) | 3787143..3787322 | + | 180 | WP_250012629.1 | hypothetical protein | - |
| M5J74_RS17630 (M5J74_17630) | 3787476..3787670 | + | 195 | WP_015155383.1 | heavy-metal-associated domain-containing protein | - |
| M5J74_RS17635 (M5J74_17635) | 3787648..3788553 | - | 906 | WP_015155384.1 | alpha/beta hydrolase | - |
| M5J74_RS17640 (M5J74_17640) | 3788634..3788870 | + | 237 | WP_015155385.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M5J74_RS17645 (M5J74_17645) | 3788864..3789196 | + | 333 | WP_015155386.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M5J74_RS17650 (M5J74_17650) | 3789254..3789466 | + | 213 | WP_015155387.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M5J74_RS17655 (M5J74_17655) | 3789453..3789854 | + | 402 | WP_015155388.1 | PIN domain nuclease | - |
| M5J74_RS17660 (M5J74_17660) | 3789924..3790898 | + | 975 | WP_250012630.1 | tyrosine-type recombinase/integrase | - |
| M5J74_RS17665 (M5J74_17665) | 3790974..3792125 | - | 1152 | WP_250012631.1 | tyrosine-type recombinase/integrase | - |
| M5J74_RS17670 (M5J74_17670) | 3792524..3793108 | + | 585 | WP_015155391.1 | DUF99 family protein | - |
| M5J74_RS17675 (M5J74_17675) | 3793242..3793577 | - | 336 | WP_250012632.1 | hypothetical protein | - |
| M5J74_RS17680 (M5J74_17680) | 3793580..3793825 | - | 246 | WP_250012633.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12562.72 Da Isoelectric Point: 9.3549
>T245499 WP_015155386.1 NZ_CP097480:3788864-3789196 [Chroococcidiopsis sp. CCNUC1]
VVEVPARGTFIWLNFEPQSGREQMGRRPALVVSHTAFNRKRGFAFVCPISNTRRKNPFYIAIPEGLAVTGVIMCDQLRSL
DYRIRNAEFLGECPISLLEEVLLRIQPIFL
VVEVPARGTFIWLNFEPQSGREQMGRRPALVVSHTAFNRKRGFAFVCPISNTRRKNPFYIAIPEGLAVTGVIMCDQLRSL
DYRIRNAEFLGECPISLLEEVLLRIQPIFL
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|