Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-UPF0150
Location 89478..89914 Replicon chromosome
Accession NZ_CP097480
Organism Chroococcidiopsis sp. CCNUC1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M5J74_RS00415 Protein ID WP_250017184.1
Coordinates 89744..89914 (+) Length 57 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M5J74_RS00410 Protein ID WP_015152182.1
Coordinates 89478..89690 (+) Length 71 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5J74_RS00390 (M5J74_00390) 85413..86474 + 1062 WP_250014886.1 tRNA 2-thiouridine(34) synthase MnmA -
M5J74_RS00395 (M5J74_00395) 86583..88373 - 1791 WP_015152179.1 translational GTPase TypA -
M5J74_RS00400 (M5J74_00400) 88472..88945 - 474 WP_015152180.1 hypothetical protein -
M5J74_RS00405 (M5J74_00405) 89111..89332 + 222 WP_015152181.1 helix-turn-helix transcriptional regulator -
M5J74_RS00410 (M5J74_00410) 89478..89690 + 213 WP_015152182.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M5J74_RS00415 (M5J74_00415) 89744..89914 + 171 WP_250017184.1 type II toxin-antitoxin system HicA family toxin Toxin
M5J74_RS00420 (M5J74_00420) 89920..90495 + 576 WP_250017185.1 HD domain-containing protein -
M5J74_RS00425 (M5J74_00425) 90564..90985 + 422 Protein_84 ABC transporter ATP-binding protein -
M5J74_RS00430 (M5J74_00430) 91124..91666 + 543 WP_250017186.1 TOBE domain-containing protein -
M5J74_RS00435 (M5J74_00435) 91788..93656 - 1869 WP_015152186.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(2-46)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(7-68)


Sequences

Toxin        


Download         Length: 57 a.a.        Molecular weight: 6410.60 Da        Isoelectric Point: 11.1563

>T245498 WP_250017184.1 NZ_CP097480:89744-89914 [Chroococcidiopsis sp. CCNUC1]
VGFQVVRQKGIYVRMQHEDGRVVTIPVHAGKNVGRGLLRKILRDAKMTREELIDLL

Download         Length: 171 bp

Antitoxin


Download         Length: 71 a.a.        Molecular weight: 8192.22 Da        Isoelectric Point: 3.8403

>AT245498 WP_015152182.1 NZ_CP097480:89478-89690 [Chroococcidiopsis sp. CCNUC1]
MNNTKEFYVIIERDEDGYYVGEVPQLKACYSQSETIDELIANIKEVIELCLEEEEYENLPEFVGIQKVVK

Download         Length: 213 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References