Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1321017..1321934 | Replicon | chromosome |
Accession | NZ_CP097467 | ||
Organism | Bacillus velezensis strain HMB26553 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | M8X21_RS07050 | Protein ID | WP_007407256.1 |
Coordinates | 1321188..1321934 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M8X21_RS07045 | Protein ID | WP_003154807.1 |
Coordinates | 1321017..1321187 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8X21_RS07005 (M8X21_07005) | 1316229..1317818 | + | 1590 | WP_029973066.1 | hypothetical protein | - |
M8X21_RS07010 (M8X21_07010) | 1317831..1318256 | + | 426 | WP_029973065.1 | hypothetical protein | - |
M8X21_RS07015 (M8X21_07015) | 1318261..1318458 | + | 198 | WP_007610833.1 | XkdX family protein | - |
M8X21_RS07020 (M8X21_07020) | 1318515..1319276 | + | 762 | WP_029973064.1 | hypothetical protein | - |
M8X21_RS07025 (M8X21_07025) | 1319328..1319591 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M8X21_RS07030 (M8X21_07030) | 1319605..1319868 | + | 264 | WP_003154813.1 | phage holin | - |
M8X21_RS07035 (M8X21_07035) | 1319882..1320760 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
M8X21_RS07040 (M8X21_07040) | 1320795..1320920 | - | 126 | WP_003154809.1 | hypothetical protein | - |
M8X21_RS07045 (M8X21_07045) | 1321017..1321187 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M8X21_RS07050 (M8X21_07050) | 1321188..1321934 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M8X21_RS07055 (M8X21_07055) | 1322038..1323036 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
M8X21_RS07060 (M8X21_07060) | 1323049..1323666 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
M8X21_RS07065 (M8X21_07065) | 1323952..1325268 | - | 1317 | WP_007610842.1 | amino acid permease | - |
M8X21_RS07070 (M8X21_07070) | 1325590..1326540 | + | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T245497 WP_007407256.1 NZ_CP097467:c1321934-1321188 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|