Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 478179..478816 | Replicon | chromosome |
| Accession | NZ_CP097467 | ||
| Organism | Bacillus velezensis strain HMB26553 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | M8X21_RS02430 | Protein ID | WP_003156187.1 |
| Coordinates | 478466..478816 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | M8X21_RS02425 | Protein ID | WP_003156188.1 |
| Coordinates | 478179..478460 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8X21_RS02405 (M8X21_02405) | 474544..475143 | - | 600 | WP_029974099.1 | rhomboid family intramembrane serine protease | - |
| M8X21_RS02410 (M8X21_02410) | 475236..475601 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
| M8X21_RS02415 (M8X21_02415) | 475766..476773 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| M8X21_RS02420 (M8X21_02420) | 476890..478059 | + | 1170 | WP_021495079.1 | alanine racemase | - |
| M8X21_RS02425 (M8X21_02425) | 478179..478460 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| M8X21_RS02430 (M8X21_02430) | 478466..478816 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M8X21_RS02435 (M8X21_02435) | 478934..479755 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| M8X21_RS02440 (M8X21_02440) | 479760..480125 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
| M8X21_RS02445 (M8X21_02445) | 480128..480529 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| M8X21_RS02450 (M8X21_02450) | 480541..481548 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| M8X21_RS02455 (M8X21_02455) | 481612..481941 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| M8X21_RS02460 (M8X21_02460) | 481938..482420 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| M8X21_RS02465 (M8X21_02465) | 482386..483174 | + | 789 | WP_029974100.1 | RNA polymerase sigma factor SigB | - |
| M8X21_RS02470 (M8X21_02470) | 483174..483776 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245496 WP_003156187.1 NZ_CP097467:478466-478816 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|