Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2477879..2478507 | Replicon | chromosome |
Accession | NZ_CP097464 | ||
Organism | Leptospira borgpetersenii strain 34-PK |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M6E4U3 |
Locus tag | LIX26_RS10535 | Protein ID | WP_002724218.1 |
Coordinates | 2478106..2478507 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LIX26_RS10530 | Protein ID | WP_010705987.1 |
Coordinates | 2477879..2478109 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX26_RS10515 (LIX26_10515) | 2475852..2476550 | - | 699 | WP_002724172.1 | hypothetical protein | - |
LIX26_RS10520 (LIX26_10520) | 2476733..2476961 | - | 229 | Protein_2080 | hypothetical protein | - |
LIX26_RS10525 (LIX26_10525) | 2477476..2477613 | - | 138 | WP_002736206.1 | hypothetical protein | - |
LIX26_RS10530 (LIX26_10530) | 2477879..2478109 | + | 231 | WP_010705987.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LIX26_RS10535 (LIX26_10535) | 2478106..2478507 | + | 402 | WP_002724218.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LIX26_RS10540 (LIX26_10540) | 2478653..2478832 | - | 180 | WP_002724268.1 | hypothetical protein | - |
LIX26_RS10545 (LIX26_10545) | 2478942..2480624 | - | 1683 | WP_002724258.1 | dihydroxy-acid dehydratase | - |
LIX26_RS10550 (LIX26_10550) | 2481033..2481578 | + | 546 | WP_170874669.1 | metal-dependent hydrolase | - |
LIX26_RS10555 (LIX26_10555) | 2482371..2482661 | + | 291 | WP_002736220.1 | YciI family protein | - |
LIX26_RS10560 (LIX26_10560) | 2482670..2483366 | - | 697 | Protein_2088 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15501.23 Da Isoelectric Point: 9.9288
>T245495 WP_002724218.1 NZ_CP097464:2478106-2478507 [Leptospira borgpetersenii]
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|