Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 559028..559683 | Replicon | chromosome |
Accession | NZ_CP097463 | ||
Organism | Jatrophihabitans sp. SB3-54 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M6B22_RS02705 | Protein ID | WP_269444238.1 |
Coordinates | 559246..559683 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M6B22_RS02700 | Protein ID | WP_269444237.1 |
Coordinates | 559028..559249 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6B22_RS02680 (M6B22_02690) | 555003..555605 | - | 603 | WP_269444233.1 | class I SAM-dependent methyltransferase | - |
M6B22_RS02685 (M6B22_02695) | 555697..556596 | + | 900 | WP_269444234.1 | ABC transporter ATP-binding protein | - |
M6B22_RS02690 (M6B22_02700) | 556593..558236 | + | 1644 | WP_269444235.1 | hypothetical protein | - |
M6B22_RS02695 (M6B22_02710) | 558508..558849 | + | 342 | WP_269444236.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
M6B22_RS02700 (M6B22_02715) | 559028..559249 | + | 222 | WP_269444237.1 | antitoxin | Antitoxin |
M6B22_RS02705 (M6B22_02720) | 559246..559683 | + | 438 | WP_269444238.1 | PIN domain nuclease | Toxin |
M6B22_RS02715 (M6B22_02730) | 559935..560303 | - | 369 | WP_269444239.1 | TIGR02611 family protein | - |
M6B22_RS02720 (M6B22_02735) | 560446..561507 | + | 1062 | WP_269444240.1 | CoA ester lyase | - |
M6B22_RS02725 (M6B22_02740) | 561500..562357 | + | 858 | WP_269444241.1 | CoA ester lyase | - |
M6B22_RS02730 (M6B22_02745) | 562364..563353 | - | 990 | WP_269444242.1 | XdhC/CoxI family protein | - |
M6B22_RS02735 (M6B22_02750) | 563387..563668 | - | 282 | WP_269444243.1 | metal-sensitive transcriptional regulator | - |
M6B22_RS02740 (M6B22_02755) | 563744..563950 | + | 207 | WP_269444244.1 | copper ion binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15852.26 Da Isoelectric Point: 6.8843
>T245492 WP_269444238.1 NZ_CP097463:559246-559683 [Jatrophihabitans sp. SB3-54]
VTAAETRRWLIDKSALVRLSESLDASEWISRIDRGLVRIATVTILEVGFSARSADDLRAKLRRPPVAAMPIENATPRIET
RAIEVQESLAGLGHHRAPSVPDLIIAAIAELAGLVVLHVDKDFELIAGVTQQPTERLRLAQPHST
VTAAETRRWLIDKSALVRLSESLDASEWISRIDRGLVRIATVTILEVGFSARSADDLRAKLRRPPVAAMPIENATPRIET
RAIEVQESLAGLGHHRAPSVPDLIIAAIAELAGLVVLHVDKDFELIAGVTQQPTERLRLAQPHST
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|