Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 54548..55107 Replicon plasmid unnamed1
Accession NZ_CP097431
Organism Escherichia coli strain C288

Toxin (Protein)


Gene name relE Uniprot ID U9YB49
Locus tag M8Y68_RS23290 Protein ID WP_000421259.1
Coordinates 54832..55107 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y625
Locus tag M8Y68_RS23285 Protein ID WP_001178087.1
Coordinates 54548..54832 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y68_RS23265 (50197) 50197..50730 - 534 WP_001372168.1 transcription termination/antitermination NusG family protein -
M8Y68_RS23270 (51172) 51172..51459 - 288 WP_000074849.1 conjugal transfer protein TraA -
M8Y68_RS23275 (51377) 51377..51655 - 279 WP_219065241.1 ash family protein -
M8Y68_RS23280 (52613) 52613..53644 + 1032 WP_052980407.1 plasmid replication initiator RepA -
M8Y68_RS23285 (54548) 54548..54832 + 285 WP_001178087.1 ribbon-helix-helix domain-containing protein Antitoxin
M8Y68_RS23290 (54832) 54832..55107 + 276 WP_000421259.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M8Y68_RS23295 (55213) 55213..55416 + 204 Protein_54 hypothetical protein -
M8Y68_RS23300 (55456) 55456..55674 - 219 Protein_55 IS1 family transposase -
M8Y68_RS23305 (55707) 55707..55910 - 204 Protein_56 Tn3 family transposase -
M8Y68_RS23310 (55973) 55973..56677 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
M8Y68_RS23315 (56717) 56717..57118 - 402 Protein_58 AAA family ATPase -
M8Y68_RS23320 (57131) 57131..57991 - 861 WP_000557452.1 aminoglycoside N-acetyltransferase AAC(3)-IIe -
M8Y68_RS23325 (58068) 58068..58928 - 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
M8Y68_RS23330 (59062) 59062..59766 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
M8Y68_RS23335 (59820) 59820..60059 + 240 Protein_62 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaTEM-1A - 1..87915 87915


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10736.45 Da        Isoelectric Point: 9.9324

>T245489 WP_000421259.1 NZ_CP097431:54832-55107 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10488.92 Da        Isoelectric Point: 5.6558

>AT245489 WP_001178087.1 NZ_CP097431:54548-54832 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWIIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YB49

Antitoxin

Source ID Structure
AlphaFold DB U9Y625

References