Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1767967..1768799 | Replicon | chromosome |
Accession | NZ_CP097430 | ||
Organism | Escherichia coli strain C288 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | M8Y68_RS08425 | Protein ID | WP_095516956.1 |
Coordinates | 1767967..1768341 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A646JF77 |
Locus tag | M8Y68_RS08430 | Protein ID | WP_033873479.1 |
Coordinates | 1768431..1768799 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y68_RS08390 (1764091) | 1764091..1764286 | - | 196 | Protein_1644 | transposase | - |
M8Y68_RS08395 (1764489) | 1764489..1764713 | - | 225 | Protein_1645 | IS110 family transposase | - |
M8Y68_RS08400 (1764820) | 1764820..1765245 | + | 426 | WP_000422741.1 | transposase | - |
M8Y68_RS08405 (1765242) | 1765242..1765592 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
M8Y68_RS08410 (1765623) | 1765623..1767236 | + | 1614 | WP_000080193.1 | IS66-like element ISEc23 family transposase | - |
M8Y68_RS08415 (1767638) | 1767638..1767718 | - | 81 | Protein_1649 | hypothetical protein | - |
M8Y68_RS08420 (1767818) | 1767818..1767970 | - | 153 | Protein_1650 | DUF5983 family protein | - |
M8Y68_RS08425 (1767967) | 1767967..1768341 | - | 375 | WP_095516956.1 | TA system toxin CbtA family protein | Toxin |
M8Y68_RS08430 (1768431) | 1768431..1768799 | - | 369 | WP_033873479.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M8Y68_RS08435 (1768962) | 1768962..1769183 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
M8Y68_RS08440 (1769246) | 1769246..1769722 | - | 477 | WP_001186774.1 | RadC family protein | - |
M8Y68_RS08445 (1769738) | 1769738..1770211 | - | 474 | WP_053290119.1 | antirestriction protein | - |
M8Y68_RS08450 (1770553) | 1770553..1771371 | - | 819 | WP_001765427.1 | DUF932 domain-containing protein | - |
M8Y68_RS08455 (1771489) | 1771489..1771684 | - | 196 | Protein_1657 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14056.08 Da Isoelectric Point: 7.2127
>T245472 WP_095516956.1 NZ_CP097430:c1768341-1767967 [Escherichia coli]
MKTLPDTHVREVSCCQSPVTIWQTLLTRLLDQYYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVSSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCQSPVTIWQTLLTRLLDQYYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVSSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13620.45 Da Isoelectric Point: 6.6255
>AT245472 WP_033873479.1 NZ_CP097430:c1768799-1768431 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYVKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYVKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|