Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 67098..67657 Replicon plasmid unnamed1
Accession NZ_CP097427
Organism Escherichia coli strain C289

Toxin (Protein)


Gene name relE Uniprot ID U9YB49
Locus tag M8Y67_RS23375 Protein ID WP_000421259.1
Coordinates 67098..67373 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y625
Locus tag M8Y67_RS23380 Protein ID WP_001178087.1
Coordinates 67373..67657 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y67_RS23330 (62146) 62146..62385 - 240 Protein_72 transposase -
M8Y67_RS23335 (62439) 62439..63143 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
M8Y67_RS23340 (63277) 63277..64137 + 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
M8Y67_RS23345 (64214) 64214..65074 + 861 WP_000557452.1 aminoglycoside N-acetyltransferase AAC(3)-IIe -
M8Y67_RS23350 (65087) 65087..65488 + 402 Protein_76 AAA family ATPase -
M8Y67_RS23355 (65528) 65528..66232 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
M8Y67_RS23360 (66295) 66295..66498 + 204 Protein_78 Tn3 family transposase -
M8Y67_RS23365 (66531) 66531..66749 + 219 Protein_79 IS1 family transposase -
M8Y67_RS23370 (66789) 66789..66992 - 204 Protein_80 hypothetical protein -
M8Y67_RS23375 (67098) 67098..67373 - 276 WP_000421259.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M8Y67_RS23380 (67373) 67373..67657 - 285 WP_001178087.1 ribbon-helix-helix domain-containing protein Antitoxin
M8Y67_RS23385 (68561) 68561..69592 - 1032 WP_052980407.1 plasmid replication initiator RepA -
M8Y67_RS23390 (70550) 70550..70828 + 279 WP_219065241.1 ash family protein -
M8Y67_RS23395 (70746) 70746..71033 + 288 WP_000074849.1 conjugal transfer protein TraA -
M8Y67_RS23400 (71475) 71475..72008 + 534 WP_001372168.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1A / aac(3)-IIa - 1..87915 87915


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10736.45 Da        Isoelectric Point: 9.9324

>T245463 WP_000421259.1 NZ_CP097427:c67373-67098 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10488.92 Da        Isoelectric Point: 5.6558

>AT245463 WP_001178087.1 NZ_CP097427:c67657-67373 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWIIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YB49

Antitoxin

Source ID Structure
AlphaFold DB U9Y625

References