Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3455162..3455780 | Replicon | chromosome |
Accession | NZ_CP097426 | ||
Organism | Escherichia coli strain C289 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M8Y67_RS16875 | Protein ID | WP_001291435.1 |
Coordinates | 3455562..3455780 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M8Y67_RS16870 | Protein ID | WP_000344800.1 |
Coordinates | 3455162..3455536 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y67_RS16860 (3450251) | 3450251..3451444 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M8Y67_RS16865 (3451467) | 3451467..3454616 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M8Y67_RS16870 (3455162) | 3455162..3455536 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M8Y67_RS16875 (3455562) | 3455562..3455780 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M8Y67_RS16880 (3455952) | 3455952..3456503 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
M8Y67_RS16885 (3456619) | 3456619..3457089 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M8Y67_RS16890 (3457253) | 3457253..3458803 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M8Y67_RS16895 (3458845) | 3458845..3459198 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M8Y67_RS16905 (3459577) | 3459577..3459888 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M8Y67_RS16910 (3459919) | 3459919..3460491 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T245454 WP_001291435.1 NZ_CP097426:3455562-3455780 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT245454 WP_000344800.1 NZ_CP097426:3455162-3455536 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |