Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2391659..2392297 | Replicon | chromosome |
Accession | NZ_CP097426 | ||
Organism | Escherichia coli strain C289 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | M8Y67_RS11640 | Protein ID | WP_001447010.1 |
Coordinates | 2392121..2392297 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M8Y67_RS11635 | Protein ID | WP_001270286.1 |
Coordinates | 2391659..2392075 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y67_RS11615 (2386811) | 2386811..2387752 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
M8Y67_RS11620 (2387753) | 2387753..2388766 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M8Y67_RS11625 (2388784) | 2388784..2389929 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
M8Y67_RS11630 (2390174) | 2390174..2391580 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
M8Y67_RS11635 (2391659) | 2391659..2392075 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M8Y67_RS11640 (2392121) | 2392121..2392297 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M8Y67_RS11645 (2392519) | 2392519..2392749 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M8Y67_RS11650 (2392841) | 2392841..2394802 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M8Y67_RS11655 (2394875) | 2394875..2395411 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M8Y67_RS11660 (2395503) | 2395503..2396678 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T245453 WP_001447010.1 NZ_CP097426:c2392297-2392121 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT245453 WP_001270286.1 NZ_CP097426:c2392075-2391659 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|