Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 13393..14036 Replicon plasmid unnamed
Accession NZ_CP097425
Organism Klebsiella pneumoniae strain K153

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag M8Y71_RS27685 Protein ID WP_000754566.1
Coordinates 13620..14036 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag M8Y71_RS27680 Protein ID WP_001261276.1
Coordinates 13393..13623 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y71_RS27645 (M8Y71_27645) 8512..8781 + 270 WP_000339857.1 hypothetical protein -
M8Y71_RS27650 (M8Y71_27650) 8958..9824 - 867 WP_004118283.1 replication initiation protein -
M8Y71_RS27655 (M8Y71_27655) 10354..10458 + 105 WP_032409716.1 hypothetical protein -
M8Y71_RS27660 (M8Y71_27660) 10587..10844 + 258 WP_000764642.1 hypothetical protein -
M8Y71_RS27665 (M8Y71_27665) 10902..11678 - 777 WP_032446863.1 site-specific integrase -
M8Y71_RS27670 (M8Y71_27670) 11675..12418 - 744 WP_000129823.1 hypothetical protein -
M8Y71_RS27675 (M8Y71_27675) 12469..12819 - 351 WP_000493378.1 hypothetical protein -
M8Y71_RS27680 (M8Y71_27680) 13393..13623 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M8Y71_RS27685 (M8Y71_27685) 13620..14036 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
M8Y71_RS27690 (M8Y71_27690) 14240..15096 + 857 Protein_16 IS3-like element ISEc15 family transposase -
M8Y71_RS27695 (M8Y71_27695) 15378..15578 + 201 Protein_17 transposase -
M8Y71_RS27700 (M8Y71_27700) 15601..16023 + 423 WP_032446862.1 hypothetical protein -
M8Y71_RS27705 (M8Y71_27705) 16032..16529 + 498 WP_032446861.1 hypothetical protein -
M8Y71_RS27710 (M8Y71_27710) 16666..17001 - 336 Protein_20 Tn3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / blaOXA-1 / qnrB1 / aac(3)-IIa - 1..51318 51318


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T245439 WP_000754566.1 NZ_CP097425:13620-14036 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT245439 WP_001261276.1 NZ_CP097425:13393-13623 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References