Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 5390434..5390950 | Replicon | chromosome |
| Accession | NZ_CP097423 | ||
| Organism | Klebsiella pneumoniae strain K153 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | M8Y71_RS26570 | Protein ID | WP_002886902.1 |
| Coordinates | 5390434..5390718 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M8Y71_RS26575 | Protein ID | WP_002886901.1 |
| Coordinates | 5390708..5390950 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Y71_RS26545 (M8Y71_26545) | 5385918..5386181 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| M8Y71_RS26550 (M8Y71_26550) | 5386311..5386484 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| M8Y71_RS26555 (M8Y71_26555) | 5386487..5387230 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M8Y71_RS26560 (M8Y71_26560) | 5387587..5389725 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M8Y71_RS26565 (M8Y71_26565) | 5389966..5390430 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M8Y71_RS26570 (M8Y71_26570) | 5390434..5390718 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8Y71_RS26575 (M8Y71_26575) | 5390708..5390950 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M8Y71_RS26580 (M8Y71_26580) | 5391028..5392938 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M8Y71_RS26585 (M8Y71_26585) | 5392961..5394115 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| M8Y71_RS26590 (M8Y71_26590) | 5394181..5394921 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T245438 WP_002886902.1 NZ_CP097423:c5390718-5390434 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |