Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4673981..4674600 Replicon chromosome
Accession NZ_CP097423
Organism Klebsiella pneumoniae strain K153

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M8Y71_RS23135 Protein ID WP_002892050.1
Coordinates 4674382..4674600 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M8Y71_RS23130 Protein ID WP_002892066.1
Coordinates 4673981..4674355 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y71_RS23120 (M8Y71_23120) 4669133..4670326 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M8Y71_RS23125 (M8Y71_23125) 4670349..4673495 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M8Y71_RS23130 (M8Y71_23130) 4673981..4674355 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M8Y71_RS23135 (M8Y71_23135) 4674382..4674600 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M8Y71_RS23140 (M8Y71_23140) 4674759..4675325 + 567 WP_002892030.1 maltose O-acetyltransferase -
M8Y71_RS23145 (M8Y71_23145) 4675297..4675437 - 141 WP_004147370.1 hypothetical protein -
M8Y71_RS23150 (M8Y71_23150) 4675458..4675928 + 471 WP_002892026.1 YlaC family protein -
M8Y71_RS23155 (M8Y71_23155) 4675903..4677354 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M8Y71_RS23160 (M8Y71_23160) 4677455..4678153 + 699 WP_002892021.1 GNAT family protein -
M8Y71_RS23165 (M8Y71_23165) 4678150..4678290 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M8Y71_RS23170 (M8Y71_23170) 4678290..4678553 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245436 WP_002892050.1 NZ_CP097423:4674382-4674600 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245436 WP_002892066.1 NZ_CP097423:4673981-4674355 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References