Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 3549876..3550612 Replicon chromosome
Accession NZ_CP097423
Organism Klebsiella pneumoniae strain K153

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M8Y71_RS17455 Protein ID WP_003026803.1
Coordinates 3550130..3550612 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M8Y71_RS17450 Protein ID WP_003026799.1
Coordinates 3549876..3550142 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y71_RS17405 (M8Y71_17405) 3545938..3546300 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M8Y71_RS17410 (M8Y71_17410) 3546350..3546700 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M8Y71_RS17415 (M8Y71_17415) 3547058..3547327 + 270 WP_004152102.1 hypothetical protein -
M8Y71_RS17420 (M8Y71_17420) 3547315..3547890 + 576 WP_004152103.1 hypothetical protein -
M8Y71_RS17425 (M8Y71_17425) 3547921..3548415 + 495 WP_004152104.1 DNA-binding protein -
M8Y71_RS17430 (M8Y71_17430) 3548459..3548827 + 369 WP_004152105.1 hypothetical protein -
M8Y71_RS17435 (M8Y71_17435) 3548861..3549064 + 204 WP_004152106.1 HHA domain-containing protein -
M8Y71_RS17440 (M8Y71_17440) 3549113..3549370 + 258 WP_004152107.1 hypothetical protein -
M8Y71_RS17445 (M8Y71_17445) 3549446..3549700 + 255 WP_004152108.1 hypothetical protein -
M8Y71_RS17450 (M8Y71_17450) 3549876..3550142 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M8Y71_RS17455 (M8Y71_17455) 3550130..3550612 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M8Y71_RS17460 (M8Y71_17460) 3550824..3552170 + 1347 WP_020314316.1 ISNCY family transposase -
M8Y71_RS27910 3552331..3552462 + 132 WP_004218042.1 hypothetical protein -
M8Y71_RS17465 (M8Y71_17465) 3552671..3553809 - 1139 Protein_3415 IS3 family transposase -
M8Y71_RS17470 (M8Y71_17470) 3554013..3554975 - 963 WP_004152113.1 zinc metalloprotease HtpX -
M8Y71_RS17475 (M8Y71_17475) 3554962..3555450 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element aph(3')-Ia / mph(A) / sul1 / qacE / aadA2 / dfrA12 - 3407555..3650630 243075


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T245435 WP_003026803.1 NZ_CP097423:3550130-3550612 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT245435 WP_003026799.1 NZ_CP097423:3549876-3550142 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References