Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1..644 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097421 | ||
| Organism | Klebsiella pneumoniae strain K229 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | M8Y66_RS27130 | Protein ID | WP_000754566.1 |
| Coordinates | 228..644 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | M8Y66_RS27125 | Protein ID | WP_001261276.1 |
| Coordinates | 1..231 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Y66_RS27125 (M8Y66_27125) | 1..231 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M8Y66_RS27130 (M8Y66_27130) | 228..644 | + | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M8Y66_RS27135 (M8Y66_27135) | 848..1704 | + | 857 | Protein_2 | IS3-like element ISEc15 family transposase | - |
| M8Y66_RS27140 (M8Y66_27140) | 1986..2186 | + | 201 | Protein_3 | transposase | - |
| M8Y66_RS27145 (M8Y66_27145) | 2209..2631 | + | 423 | WP_032446862.1 | hypothetical protein | - |
| M8Y66_RS27150 (M8Y66_27150) | 2640..3137 | + | 498 | WP_032446861.1 | hypothetical protein | - |
| M8Y66_RS27155 (M8Y66_27155) | 3274..3609 | - | 336 | Protein_6 | Tn3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / dfrA12 / aadA2 / qacE / sul1 / mph(A) | - | 1..96910 | 96910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T245423 WP_000754566.1 NZ_CP097421:228-644 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |