Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 56797..57533 Replicon plasmid unnamed1
Accession NZ_CP097420
Organism Klebsiella pneumoniae strain K229

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M8Y66_RS26640 Protein ID WP_003026803.1
Coordinates 56797..57279 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M8Y66_RS26645 Protein ID WP_003026799.1
Coordinates 57267..57533 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y66_RS26620 (M8Y66_26620) 51959..52447 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
M8Y66_RS26625 (M8Y66_26625) 52434..53396 + 963 WP_004152113.1 zinc metalloprotease HtpX -
M8Y66_RS26630 (M8Y66_26630) 53573..54738 + 1166 Protein_61 IS3 family transposase -
M8Y66_RS27985 54947..55078 - 132 WP_004218042.1 hypothetical protein -
M8Y66_RS26635 (M8Y66_26635) 55239..56585 - 1347 WP_020314316.1 ISNCY family transposase -
M8Y66_RS26640 (M8Y66_26640) 56797..57279 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M8Y66_RS26645 (M8Y66_26645) 57267..57533 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M8Y66_RS26650 (M8Y66_26650) 57709..57963 - 255 WP_004152108.1 hypothetical protein -
M8Y66_RS26655 (M8Y66_26655) 58039..58296 - 258 WP_004152107.1 hypothetical protein -
M8Y66_RS26660 (M8Y66_26660) 58345..58548 - 204 WP_004152106.1 HHA domain-containing protein -
M8Y66_RS26665 (M8Y66_26665) 58582..58950 - 369 WP_004152105.1 hypothetical protein -
M8Y66_RS26670 (M8Y66_26670) 58994..59488 - 495 WP_004152104.1 DNA-binding protein -
M8Y66_RS26675 (M8Y66_26675) 59519..60094 - 576 WP_004152103.1 hypothetical protein -
M8Y66_RS26680 (M8Y66_26680) 60082..60351 - 270 WP_004152102.1 hypothetical protein -
M8Y66_RS26685 (M8Y66_26685) 60709..61059 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M8Y66_RS26690 (M8Y66_26690) 61109..61471 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / aac(3)-IIa / aph(3')-Ia - 1..143352 143352


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T245422 WP_003026803.1 NZ_CP097420:c57279-56797 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT245422 WP_003026799.1 NZ_CP097420:c57533-57267 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References