Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53674..54410 Replicon plasmid unnamed1
Accession NZ_CP097416
Organism Klebsiella pneumoniae strain K163

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M8Y70_RS26365 Protein ID WP_003026803.1
Coordinates 53928..54410 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M8Y70_RS26360 Protein ID WP_003026799.1
Coordinates 53674..53940 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y70_RS26315 (M8Y70_26315) 49736..50098 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M8Y70_RS26320 (M8Y70_26320) 50148..50498 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M8Y70_RS26325 (M8Y70_26325) 50856..51125 + 270 WP_004152102.1 hypothetical protein -
M8Y70_RS26330 (M8Y70_26330) 51113..51688 + 576 WP_004152103.1 hypothetical protein -
M8Y70_RS26335 (M8Y70_26335) 51719..52213 + 495 WP_004152104.1 DNA-binding protein -
M8Y70_RS26340 (M8Y70_26340) 52257..52625 + 369 WP_004152105.1 hypothetical protein -
M8Y70_RS26345 (M8Y70_26345) 52659..52862 + 204 WP_004152106.1 HHA domain-containing protein -
M8Y70_RS26350 (M8Y70_26350) 52911..53168 + 258 WP_004152107.1 hypothetical protein -
M8Y70_RS26355 (M8Y70_26355) 53244..53498 + 255 WP_004152108.1 hypothetical protein -
M8Y70_RS26360 (M8Y70_26360) 53674..53940 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M8Y70_RS26365 (M8Y70_26365) 53928..54410 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M8Y70_RS26370 (M8Y70_26370) 54618..55964 + 1347 WP_077253535.1 ISNCY family transposase -
M8Y70_RS26375 (M8Y70_26375) 56013..56408 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
M8Y70_RS26380 (M8Y70_26380) 56556..57721 - 1166 Protein_59 IS3 family transposase -
M8Y70_RS26385 (M8Y70_26385) 57898..58860 - 963 WP_004152113.1 zinc metalloprotease HtpX -
M8Y70_RS26390 (M8Y70_26390) 58847..59335 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 - 1..223898 223898


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T245407 WP_003026803.1 NZ_CP097416:53928-54410 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT245407 WP_003026799.1 NZ_CP097416:53674-53940 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References