Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4040005..4040624 Replicon chromosome
Accession NZ_CP097415
Organism Klebsiella pneumoniae strain K163

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M8Y70_RS19805 Protein ID WP_002892050.1
Coordinates 4040406..4040624 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M8Y70_RS19800 Protein ID WP_002892066.1
Coordinates 4040005..4040379 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y70_RS19790 (4035157) 4035157..4036350 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M8Y70_RS19795 (4036373) 4036373..4039519 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M8Y70_RS19800 (4040005) 4040005..4040379 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M8Y70_RS19805 (4040406) 4040406..4040624 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M8Y70_RS19810 (4040783) 4040783..4041349 + 567 WP_002892030.1 maltose O-acetyltransferase -
M8Y70_RS19815 (4041321) 4041321..4041461 - 141 WP_004147370.1 hypothetical protein -
M8Y70_RS19820 (4041482) 4041482..4041952 + 471 WP_002892026.1 YlaC family protein -
M8Y70_RS19825 (4041927) 4041927..4043378 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
M8Y70_RS19830 (4043479) 4043479..4044177 + 699 WP_032435564.1 GNAT family protein -
M8Y70_RS19835 (4044174) 4044174..4044314 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M8Y70_RS19840 (4044314) 4044314..4044577 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245401 WP_002892050.1 NZ_CP097415:4040406-4040624 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245401 WP_002892066.1 NZ_CP097415:4040005-4040379 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References