Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4806620..4807136 | Replicon | chromosome |
Accession | NZ_CP097411 | ||
Organism | Klebsiella pneumoniae strain K165-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M8Y69_RS23425 | Protein ID | WP_004178374.1 |
Coordinates | 4806620..4806904 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | M8Y69_RS23430 | Protein ID | WP_032434351.1 |
Coordinates | 4806894..4807136 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y69_RS23400 (4802103) | 4802103..4802366 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
M8Y69_RS23405 (4802496) | 4802496..4802669 | + | 174 | WP_032414379.1 | hypothetical protein | - |
M8Y69_RS23410 (4802672) | 4802672..4803415 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M8Y69_RS23415 (4803772) | 4803772..4805910 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M8Y69_RS23420 (4806152) | 4806152..4806616 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M8Y69_RS23425 (4806620) | 4806620..4806904 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8Y69_RS23430 (4806894) | 4806894..4807136 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M8Y69_RS23435 (4807214) | 4807214..4809124 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M8Y69_RS23440 (4809147) | 4809147..4810301 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M8Y69_RS23445 (4810367) | 4810367..4811107 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T245388 WP_004178374.1 NZ_CP097411:c4806904-4806620 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|