Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4713892..4714595 | Replicon | chromosome |
| Accession | NZ_CP097411 | ||
| Organism | Klebsiella pneumoniae strain K165-2 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | M8Y69_RS23035 | Protein ID | WP_071994632.1 |
| Coordinates | 4713892..4714233 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | M8Y69_RS23040 | Protein ID | WP_032434296.1 |
| Coordinates | 4714254..4714595 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Y69_RS23025 (4710207) | 4710207..4711076 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| M8Y69_RS23030 (4711667) | 4711667..4713700 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
| M8Y69_RS23035 (4713892) | 4713892..4714233 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| M8Y69_RS23040 (4714254) | 4714254..4714595 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M8Y69_RS23045 (4714606) | 4714606..4715148 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| M8Y69_RS23050 (4715161) | 4715161..4715601 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| M8Y69_RS23055 (4715632) | 4715632..4716453 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| M8Y69_RS23060 (4716573) | 4716573..4717046 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| M8Y69_RS23065 (4717118) | 4717118..4717570 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| M8Y69_RS23070 (4717606) | 4717606..4718322 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| M8Y69_RS23075 (4718566) | 4718566..4719440 | - | 875 | Protein_4528 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4702189..4747862 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T245387 WP_071994632.1 NZ_CP097411:c4714233-4713892 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|