Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4041521..4042140 Replicon chromosome
Accession NZ_CP097411
Organism Klebsiella pneumoniae strain K165-2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M8Y69_RS19820 Protein ID WP_002892050.1
Coordinates 4041922..4042140 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M8Y69_RS19815 Protein ID WP_002892066.1
Coordinates 4041521..4041895 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y69_RS19805 (4036673) 4036673..4037866 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M8Y69_RS19810 (4037889) 4037889..4041035 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M8Y69_RS19815 (4041521) 4041521..4041895 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M8Y69_RS19820 (4041922) 4041922..4042140 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M8Y69_RS19825 (4042299) 4042299..4042865 + 567 WP_002892030.1 maltose O-acetyltransferase -
M8Y69_RS19830 (4042837) 4042837..4042977 - 141 WP_004147370.1 hypothetical protein -
M8Y69_RS19835 (4042998) 4042998..4043468 + 471 WP_002892026.1 YlaC family protein -
M8Y69_RS19840 (4043443) 4043443..4044894 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
M8Y69_RS19845 (4044995) 4044995..4045693 + 699 WP_032435564.1 GNAT family protein -
M8Y69_RS19850 (4045690) 4045690..4045830 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M8Y69_RS19855 (4045830) 4045830..4046093 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245385 WP_002892050.1 NZ_CP097411:4041922-4042140 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245385 WP_002892066.1 NZ_CP097411:4041521-4041895 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References