Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4041521..4042140 | Replicon | chromosome |
Accession | NZ_CP097411 | ||
Organism | Klebsiella pneumoniae strain K165-2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M8Y69_RS19820 | Protein ID | WP_002892050.1 |
Coordinates | 4041922..4042140 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M8Y69_RS19815 | Protein ID | WP_002892066.1 |
Coordinates | 4041521..4041895 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y69_RS19805 (4036673) | 4036673..4037866 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M8Y69_RS19810 (4037889) | 4037889..4041035 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M8Y69_RS19815 (4041521) | 4041521..4041895 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M8Y69_RS19820 (4041922) | 4041922..4042140 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M8Y69_RS19825 (4042299) | 4042299..4042865 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M8Y69_RS19830 (4042837) | 4042837..4042977 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M8Y69_RS19835 (4042998) | 4042998..4043468 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M8Y69_RS19840 (4043443) | 4043443..4044894 | - | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
M8Y69_RS19845 (4044995) | 4044995..4045693 | + | 699 | WP_032435564.1 | GNAT family protein | - |
M8Y69_RS19850 (4045690) | 4045690..4045830 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M8Y69_RS19855 (4045830) | 4045830..4046093 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T245385 WP_002892050.1 NZ_CP097411:4041922-4042140 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT245385 WP_002892066.1 NZ_CP097411:4041521-4041895 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |