Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 22772..23511 | Replicon | plasmid pKPTCM-4 |
| Accession | NZ_CP097389 | ||
| Organism | Klebsiella pneumoniae strain KPTCM | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A9E6WPH7 |
| Locus tag | M6G79_RS27340 | Protein ID | WP_013087269.1 |
| Coordinates | 23026..23511 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A9E6WPN8 |
| Locus tag | M6G79_RS27335 | Protein ID | WP_007869691.1 |
| Coordinates | 22772..23038 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G79_RS27305 (M6G79_27285) | 17824..18180 | + | 357 | WP_004199403.1 | hypothetical protein | - |
| M6G79_RS27310 (M6G79_27290) | 18214..18918 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M6G79_RS27315 (M6G79_27295) | 18973..19497 | - | 525 | Protein_26 | NAD(P)-dependent oxidoreductase | - |
| M6G79_RS27320 (M6G79_27300) | 19759..20520 | + | 762 | WP_002210513.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| M6G79_RS27325 (M6G79_27305) | 20541..21401 | - | 861 | WP_002904004.1 | extended-spectrum class A beta-lactamase SHV-12 | - |
| M6G79_RS27330 (M6G79_27310) | 21538..22242 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M6G79_RS27335 (M6G79_27315) | 22772..23038 | + | 267 | WP_007869691.1 | DUF1778 domain-containing protein | Antitoxin |
| M6G79_RS27340 (M6G79_27320) | 23026..23511 | + | 486 | WP_013087269.1 | GNAT family N-acetyltransferase | Toxin |
| M6G79_RS27345 (M6G79_27325) | 23708..25111 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| M6G79_RS27350 (M6G79_27330) | 25140..25772 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| M6G79_RS27355 (M6G79_27335) | 26162..26980 | - | 819 | WP_013087268.1 | abortive infection family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaSHV-12 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..50463 | 50463 | |
| - | inside | IScluster/Tn | blaSHV-12 | - | 16260..25111 | 8851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17736.45 Da Isoelectric Point: 9.5181
>T245375 WP_013087269.1 NZ_CP097389:23026-23511 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|