Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 41585..42110 Replicon plasmid pKPTCM-3
Accession NZ_CP097388
Organism Klebsiella pneumoniae strain KPTCM

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag M6G79_RS26700 Protein ID WP_013023785.1
Coordinates 41805..42110 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1D8K3R4
Locus tag M6G79_RS26695 Protein ID WP_006788213.1
Coordinates 41585..41803 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M6G79_RS26660 (M6G79_26635) 37105..37641 + 537 WP_223825639.1 hypothetical protein -
M6G79_RS26665 (M6G79_26640) 37659..37982 + 324 WP_085842301.1 hypothetical protein -
M6G79_RS26670 (M6G79_26645) 38023..38439 - 417 WP_032425563.1 type II toxin-antitoxin system VapC family toxin -
M6G79_RS26675 (M6G79_26650) 38436..38666 - 231 WP_016338373.1 type II toxin-antitoxin system VapB family antitoxin -
M6G79_RS26680 (M6G79_26655) 38884..39798 - 915 WP_126834912.1 Abi family protein -
M6G79_RS26685 (M6G79_26660) 40091..41044 - 954 WP_109549184.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
M6G79_RS26690 (M6G79_26665) 41152..41415 + 264 Protein_51 hypothetical protein -
M6G79_RS26695 (M6G79_26670) 41585..41803 + 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M6G79_RS26700 (M6G79_26675) 41805..42110 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
M6G79_RS26705 (M6G79_26680) 42279..42674 + 396 WP_017899885.1 hypothetical protein -
M6G79_RS26710 (M6G79_26685) 42701..43015 + 315 WP_053389906.1 hypothetical protein -
M6G79_RS26715 (M6G79_26690) 43026..44042 + 1017 WP_017899884.1 hypothetical protein -
M6G79_RS26720 (M6G79_26695) 44240..45034 + 795 WP_004197635.1 site-specific integrase -
M6G79_RS26725 (M6G79_26700) 45474..45776 - 303 WP_071571079.1 hypothetical protein -
M6G79_RS26730 (M6G79_26705) 45773..46399 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / dfrA14 - 1..116556 116556


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T245374 WP_013023785.1 NZ_CP097388:41805-42110 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7405

>AT245374 WP_006788213.1 NZ_CP097388:41585-41803 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISGLVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1D8K3R4

References