Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 38023..38666 Replicon plasmid pKPTCM-3
Accession NZ_CP097388
Organism Klebsiella pneumoniae strain KPTCM

Toxin (Protein)


Gene name vagD Uniprot ID A0A7D6UII7
Locus tag M6G79_RS26670 Protein ID WP_032425563.1
Coordinates 38023..38439 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID R4IT22
Locus tag M6G79_RS26675 Protein ID WP_016338373.1
Coordinates 38436..38666 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M6G79_RS26650 (M6G79_26625) 33071..35179 - 2109 WP_016338368.1 peptidase domain-containing ABC transporter -
M6G79_RS26655 (M6G79_26630) 35169..36446 - 1278 WP_016338369.1 HlyD family secretion protein -
M6G79_RS26660 (M6G79_26635) 37105..37641 + 537 WP_223825639.1 hypothetical protein -
M6G79_RS26665 (M6G79_26640) 37659..37982 + 324 WP_085842301.1 hypothetical protein -
M6G79_RS26670 (M6G79_26645) 38023..38439 - 417 WP_032425563.1 type II toxin-antitoxin system VapC family toxin Toxin
M6G79_RS26675 (M6G79_26650) 38436..38666 - 231 WP_016338373.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M6G79_RS26680 (M6G79_26655) 38884..39798 - 915 WP_126834912.1 Abi family protein -
M6G79_RS26685 (M6G79_26660) 40091..41044 - 954 WP_109549184.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
M6G79_RS26690 (M6G79_26665) 41152..41415 + 264 Protein_51 hypothetical protein -
M6G79_RS26695 (M6G79_26670) 41585..41803 + 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA -
M6G79_RS26700 (M6G79_26675) 41805..42110 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
M6G79_RS26705 (M6G79_26680) 42279..42674 + 396 WP_017899885.1 hypothetical protein -
M6G79_RS26710 (M6G79_26685) 42701..43015 + 315 WP_053389906.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / dfrA14 - 1..116556 116556


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15080.56 Da        Isoelectric Point: 8.5403

>T245373 WP_032425563.1 NZ_CP097388:c38439-38023 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8751.77 Da        Isoelectric Point: 4.3533

>AT245373 WP_016338373.1 NZ_CP097388:c38666-38436 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWSSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6UII7

Antitoxin

Source ID Structure
AlphaFold DB A0A5Q9LN61

References