Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 93489..94159 Replicon plasmid pKPTCM-1
Accession NZ_CP097386
Organism Klebsiella pneumoniae strain KPTCM

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag M6G79_RS25370 Protein ID WP_004213072.1
Coordinates 93489..93932 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag M6G79_RS25375 Protein ID WP_004213073.1
Coordinates 93929..94159 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M6G79_RS25335 (M6G79_25310) 88898..89173 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
M6G79_RS25340 (M6G79_25315) 89236..89727 + 492 WP_011251327.1 DM13 domain-containing protein -
M6G79_RS25345 (M6G79_25320) 89776..90696 + 921 WP_029884592.1 DUF1471 domain-containing protein -
M6G79_RS25350 (M6G79_25325) 90787..91190 + 404 Protein_94 GAF domain-containing protein -
M6G79_RS25355 (M6G79_25330) 91708..92346 - 639 WP_032488580.1 mucoid phenotype regulator RmpA2 -
M6G79_RS25360 (M6G79_25335) 92762..93066 + 305 Protein_96 transposase -
M6G79_RS25365 (M6G79_25340) 93089..93340 - 252 WP_186987481.1 hypothetical protein -
M6G79_RS25370 (M6G79_25345) 93489..93932 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
M6G79_RS25375 (M6G79_25350) 93929..94159 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M6G79_RS25380 (M6G79_25355) 94767..95900 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
M6G79_RS25385 (M6G79_25360) 95916..96209 + 294 WP_004213076.1 hypothetical protein -
M6G79_RS25390 (M6G79_25365) 96199..96405 - 207 WP_004213077.1 hypothetical protein -
M6G79_RS25395 (M6G79_25370) 96757..97047 + 291 WP_004213078.1 hypothetical protein -
M6G79_RS25400 (M6G79_25375) 97037..97936 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA 1..167179 167179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T245371 WP_004213072.1 NZ_CP097386:c93932-93489 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT245371 WP_004213073.1 NZ_CP097386:c94159-93929 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References