Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5667247..5667833 | Replicon | chromosome |
Accession | NZ_CP097383 | ||
Organism | Pseudomonas aeruginosa strain L00-a |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | M8G39_RS26765 | Protein ID | WP_003120987.1 |
Coordinates | 5667534..5667833 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | M8G39_RS26760 | Protein ID | WP_003448662.1 |
Coordinates | 5667247..5667537 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8G39_RS26740 (M8G39_26740) | 5662398..5662607 | + | 210 | WP_003105733.1 | cold-shock protein | - |
M8G39_RS26745 (M8G39_26745) | 5662829..5664718 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
M8G39_RS26750 (M8G39_26750) | 5664715..5666691 | + | 1977 | WP_034005499.1 | DEAD/DEAH box helicase | - |
M8G39_RS26755 (M8G39_26755) | 5666832..5667176 | + | 345 | WP_016851612.1 | hypothetical protein | - |
M8G39_RS26760 (M8G39_26760) | 5667247..5667537 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
M8G39_RS26765 (M8G39_26765) | 5667534..5667833 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8G39_RS26770 (M8G39_26770) | 5668035..5669159 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
M8G39_RS26775 (M8G39_26775) | 5669159..5670868 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
M8G39_RS26780 (M8G39_26780) | 5670872..5672197 | + | 1326 | WP_031806139.1 | type 4b pilus protein PilO2 | - |
M8G39_RS26785 (M8G39_26785) | 5672187..5672720 | + | 534 | WP_023094340.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5640268..5734849 | 94581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T245355 WP_003120987.1 NZ_CP097383:c5667833-5667534 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|