Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 151736..152241 | Replicon | chromosome |
Accession | NZ_CP097383 | ||
Organism | Pseudomonas aeruginosa strain L00-a |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M8G39_RS00700 | Protein ID | WP_003083773.1 |
Coordinates | 151736..152017 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M8G39_RS00705 | Protein ID | WP_003083775.1 |
Coordinates | 152014..152241 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8G39_RS00675 (M8G39_00675) | 146987..148336 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
M8G39_RS00680 (M8G39_00680) | 148385..149071 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M8G39_RS00685 (M8G39_00685) | 149172..149906 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
M8G39_RS00690 (M8G39_00690) | 150086..150496 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
M8G39_RS00695 (M8G39_00695) | 150528..151436 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
M8G39_RS00700 (M8G39_00700) | 151736..152017 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M8G39_RS00705 (M8G39_00705) | 152014..152241 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M8G39_RS00710 (M8G39_00710) | 152417..153037 | - | 621 | WP_003101226.1 | hypothetical protein | - |
M8G39_RS00715 (M8G39_00715) | 153138..153638 | + | 501 | WP_003162763.1 | LEA type 2 family protein | - |
M8G39_RS00720 (M8G39_00720) | 153711..154052 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
M8G39_RS00725 (M8G39_00725) | 154134..155561 | - | 1428 | WP_003083784.1 | GABA permease | - |
M8G39_RS00730 (M8G39_00730) | 155730..157223 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T245350 WP_003083773.1 NZ_CP097383:c152017-151736 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|