Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1529218..1529875 | Replicon | chromosome |
| Accession | NZ_CP097380 | ||
| Organism | Providencia stuartii strain P14 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7T1H2A7 |
| Locus tag | M8G38_RS06755 | Protein ID | WP_036941148.1 |
| Coordinates | 1529465..1529875 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | B2Q1I8 |
| Locus tag | M8G38_RS06750 | Protein ID | WP_004921708.1 |
| Coordinates | 1529218..1529484 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8G38_RS06735 (M8G38_06735) | 1524249..1527125 | + | 2877 | WP_004921716.1 | aminomethyl-transferring glycine dehydrogenase | - |
| M8G38_RS06740 (M8G38_06740) | 1527344..1527964 | - | 621 | WP_004921714.1 | HD domain-containing protein | - |
| M8G38_RS06745 (M8G38_06745) | 1527976..1528965 | - | 990 | WP_004921711.1 | tRNA-modifying protein YgfZ | - |
| M8G38_RS06750 (M8G38_06750) | 1529218..1529484 | + | 267 | WP_004921708.1 | FAD assembly factor SdhE | Antitoxin |
| M8G38_RS06755 (M8G38_06755) | 1529465..1529875 | + | 411 | WP_036941148.1 | protein YgfX | Toxin |
| M8G38_RS06760 (M8G38_06760) | 1529921..1530439 | - | 519 | WP_088499135.1 | flavodoxin FldB | - |
| M8G38_RS06765 (M8G38_06765) | 1530602..1531525 | + | 924 | WP_004921697.1 | site-specific tyrosine recombinase XerD | - |
| M8G38_RS06770 (M8G38_06770) | 1531545..1532249 | + | 705 | WP_004921696.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M8G38_RS06775 (M8G38_06775) | 1532255..1533988 | + | 1734 | WP_004921693.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15289.15 Da Isoelectric Point: 10.8779
>T245347 WP_036941148.1 NZ_CP097380:1529465-1529875 [Providencia stuartii]
VVLWKSNLSISWKTQLFSTCAHGVVGFILLVAPWAPGNSMVWLPLLVIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWSIVKQPWCSRVGVLLTLSALQGKPQKIRLWVAKDALSEESWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCAHGVVGFILLVAPWAPGNSMVWLPLLVIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWSIVKQPWCSRVGVLLTLSALQGKPQKIRLWVAKDALSEESWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T1H2A7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140NIX0 |