Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 878296..878947 | Replicon | chromosome |
| Accession | NZ_CP097380 | ||
| Organism | Providencia stuartii strain P14 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | K8W3H1 |
| Locus tag | M8G38_RS03775 | Protein ID | WP_004927064.1 |
| Coordinates | 878296..878499 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B2Q721 |
| Locus tag | M8G38_RS03780 | Protein ID | WP_004927067.1 |
| Coordinates | 878579..878947 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8G38_RS03750 (M8G38_03750) | 874174..874512 | + | 339 | WP_004927053.1 | P-II family nitrogen regulator | - |
| M8G38_RS03755 (M8G38_03755) | 874523..875806 | + | 1284 | WP_014656764.1 | ammonium transporter AmtB | - |
| M8G38_RS03760 (M8G38_03760) | 876043..876909 | - | 867 | WP_004927058.1 | acyl-CoA thioesterase II | - |
| M8G38_RS03765 (M8G38_03765) | 877233..877691 | + | 459 | WP_004927062.1 | YbaY family lipoprotein | - |
| M8G38_RS03775 (M8G38_03775) | 878296..878499 | - | 204 | WP_004927064.1 | HHA domain-containing protein | Toxin |
| M8G38_RS03780 (M8G38_03780) | 878579..878947 | - | 369 | WP_004927067.1 | Hha toxicity modulator TomB | Antitoxin |
| M8G38_RS03785 (M8G38_03785) | 879515..880852 | - | 1338 | WP_004927077.1 | murein transglycosylase D | - |
| M8G38_RS03790 (M8G38_03790) | 880931..881686 | - | 756 | WP_040132835.1 | hydroxyacylglutathione hydrolase | - |
| M8G38_RS03795 (M8G38_03795) | 881720..882445 | + | 726 | WP_121874720.1 | class I SAM-dependent methyltransferase | - |
| M8G38_RS03800 (M8G38_03800) | 882524..882994 | - | 471 | WP_014656762.1 | ribonuclease HI | - |
| M8G38_RS03805 (M8G38_03805) | 883049..883810 | + | 762 | WP_004927092.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8075.37 Da Isoelectric Point: 6.9770
>T245346 WP_004927064.1 NZ_CP097380:c878499-878296 [Providencia stuartii]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14149.01 Da Isoelectric Point: 4.2591
>AT245346 WP_004927067.1 NZ_CP097380:c878947-878579 [Providencia stuartii]
MDEYSPKNYDISELKYLCNSLNREAMLSLQKTNTHWVNDLSSPQSARLNELIEHIAAFVWQFKIKYPKENLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVSVLDDDLKCPASKT
MDEYSPKNYDISELKYLCNSLNREAMLSLQKTNTHWVNDLSSPQSARLNELIEHIAAFVWQFKIKYPKENLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVSVLDDDLKCPASKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K8W3H1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140NKN2 |