Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 2046754..2047469 | Replicon | chromosome |
Accession | NZ_CP097377 | ||
Organism | Actinobacillus pleuropneumoniae strain GD2107 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M6G44_RS09720 | Protein ID | WP_005599445.1 |
Coordinates | 2046754..2047119 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B0BT01 |
Locus tag | M6G44_RS09725 | Protein ID | WP_005599447.1 |
Coordinates | 2047182..2047469 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6G44_RS09705 (M6G44_09705) | 2042339..2044045 | - | 1707 | WP_237593915.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
M6G44_RS09710 (M6G44_09710) | 2044141..2044422 | - | 282 | WP_005599441.1 | DNA-directed RNA polymerase subunit omega | - |
M6G44_RS09715 (M6G44_09715) | 2044549..2046630 | - | 2082 | WP_237601098.1 | ATP-dependent DNA helicase RecG | - |
M6G44_RS09720 (M6G44_09720) | 2046754..2047119 | - | 366 | WP_005599445.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M6G44_RS09725 (M6G44_09725) | 2047182..2047469 | - | 288 | WP_005599447.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M6G44_RS09730 (M6G44_09730) | 2047675..2049390 | + | 1716 | WP_005618303.1 | proline--tRNA ligase | - |
M6G44_RS09735 (M6G44_09735) | 2049456..2049644 | - | 189 | WP_005618305.1 | hypothetical protein | - |
M6G44_RS09740 (M6G44_09740) | 2049647..2050228 | - | 582 | WP_005599450.1 | sigma-70 family RNA polymerase sigma factor | - |
M6G44_RS09745 (M6G44_09745) | 2050317..2051273 | + | 957 | WP_005619040.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
M6G44_RS09750 (M6G44_09750) | 2051273..2051866 | + | 594 | WP_005599453.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13974.06 Da Isoelectric Point: 9.0549
>T245344 WP_005599445.1 NZ_CP097377:c2047119-2046754 [Actinobacillus pleuropneumoniae]
MDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQAKSFSINNEIALLASEYHIPNK
MDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
MDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQAKSFSINNEIALLASEYHIPNK
MDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|