Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1895154..1895885 | Replicon | chromosome |
Accession | NZ_CP097377 | ||
Organism | Actinobacillus pleuropneumoniae strain GD2107 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A448U107 |
Locus tag | M6G44_RS08865 | Protein ID | WP_005602211.1 |
Coordinates | 1895418..1895885 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | B0BRD3 |
Locus tag | M6G44_RS08860 | Protein ID | WP_005619269.1 |
Coordinates | 1895154..1895414 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6G44_RS08840 (M6G44_08840) | 1890972..1891865 | + | 894 | WP_005618012.1 | site-specific tyrosine recombinase XerD | - |
M6G44_RS08845 (M6G44_08845) | 1891867..1892157 | + | 291 | WP_005602215.1 | DUF5389 family protein | - |
M6G44_RS08850 (M6G44_08850) | 1892184..1893443 | - | 1260 | WP_005618010.1 | tRNA lysidine(34) synthetase TilS | - |
M6G44_RS08855 (M6G44_08855) | 1893573..1895033 | + | 1461 | WP_237601108.1 | metalloprotease TldD | - |
M6G44_RS08860 (M6G44_08860) | 1895154..1895414 | + | 261 | WP_005619269.1 | DUF1778 domain-containing protein | Antitoxin |
M6G44_RS08865 (M6G44_08865) | 1895418..1895885 | + | 468 | WP_005602211.1 | GNAT family N-acetyltransferase | Toxin |
M6G44_RS08870 (M6G44_08870) | 1895969..1896850 | + | 882 | WP_012478550.1 | 50S ribosomal protein L11 methyltransferase | - |
M6G44_RS08875 (M6G44_08875) | 1896917..1897831 | - | 915 | WP_005618000.1 | N-acetylmuramic acid 6-phosphate etherase | - |
M6G44_RS08880 (M6G44_08880) | 1897885..1898994 | - | 1110 | WP_005617998.1 | anhydro-N-acetylmuramic acid kinase | - |
M6G44_RS08885 (M6G44_08885) | 1899089..1900153 | + | 1065 | WP_012478549.1 | MFS transporter | - |
M6G44_RS08890 (M6G44_08890) | 1900156..1900527 | + | 372 | WP_005598830.1 | CrcB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17192.19 Da Isoelectric Point: 8.9312
>T245343 WP_005602211.1 NZ_CP097377:1895418-1895885 [Actinobacillus pleuropneumoniae]
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A448U107 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A3N2I7 |