Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1678135..1678763 | Replicon | chromosome |
Accession | NZ_CP097377 | ||
Organism | Actinobacillus pleuropneumoniae strain GD2107 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M6G44_RS07820 | Protein ID | WP_005618201.1 |
Coordinates | 1678135..1678533 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B3GYV7 |
Locus tag | M6G44_RS07825 | Protein ID | WP_005613300.1 |
Coordinates | 1678533..1678763 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6G44_RS07795 (M6G44_07795) | 1673757..1674278 | + | 522 | WP_005618211.1 | ATP-dependent protease subunit HslV | - |
M6G44_RS07800 (M6G44_07800) | 1674333..1675655 | + | 1323 | WP_005620148.1 | HslU--HslV peptidase ATPase subunit | - |
M6G44_RS07805 (M6G44_07805) | 1675728..1676507 | + | 780 | WP_005602546.1 | hypothetical protein | - |
M6G44_RS07810 (M6G44_07810) | 1676687..1677337 | - | 651 | WP_005618207.1 | DUF2202 domain-containing protein | - |
M6G44_RS07815 (M6G44_07815) | 1677583..1677999 | + | 417 | WP_005618204.1 | DUF417 family protein | - |
M6G44_RS07820 (M6G44_07820) | 1678135..1678533 | - | 399 | WP_005618201.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
M6G44_RS07825 (M6G44_07825) | 1678533..1678763 | - | 231 | WP_005613300.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M6G44_RS07830 (M6G44_07830) | 1679284..1680915 | - | 1632 | WP_005618198.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1644846..1693445 | 48599 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15124.41 Da Isoelectric Point: 6.9683
>T245342 WP_005618201.1 NZ_CP097377:c1678533-1678135 [Actinobacillus pleuropneumoniae]
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYDAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKCGKILGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLDNWV
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYDAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKCGKILGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLDNWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|