Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1522696..1523341 | Replicon | chromosome |
Accession | NZ_CP097377 | ||
Organism | Actinobacillus pleuropneumoniae strain GD2107 |
Toxin (Protein)
Gene name | toxT | Uniprot ID | B0BQU7 |
Locus tag | M6G44_RS07050 | Protein ID | WP_005619674.1 |
Coordinates | 1522970..1523341 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | M6G44_RS07045 | Protein ID | WP_005598477.1 |
Coordinates | 1522696..1522989 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6G44_RS07015 (M6G44_07015) | 1518028..1518711 | - | 684 | WP_005605188.1 | arginine ABC transporter permease ArtM | - |
M6G44_RS07020 (M6G44_07020) | 1518711..1519382 | - | 672 | WP_005617821.1 | arginine ABC transporter permease ArtQ | - |
M6G44_RS07025 (M6G44_07025) | 1519388..1520107 | - | 720 | WP_012478527.1 | transporter substrate-binding domain-containing protein | - |
M6G44_RS07030 (M6G44_07030) | 1520127..1520861 | - | 735 | WP_005598473.1 | arginine ABC transporter ATP-binding protein ArtP | - |
M6G44_RS07035 (M6G44_07035) | 1521086..1521583 | - | 498 | WP_005617825.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
M6G44_RS07040 (M6G44_07040) | 1521656..1522618 | + | 963 | WP_012478528.1 | calcium/sodium antiporter | - |
M6G44_RS07045 (M6G44_07045) | 1522696..1522989 | - | 294 | WP_005598477.1 | helix-turn-helix domain-containing protein | Antitoxin |
M6G44_RS07050 (M6G44_07050) | 1522970..1523341 | - | 372 | WP_005619674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M6G44_RS07055 (M6G44_07055) | 1523535..1525286 | + | 1752 | WP_237601096.1 | protein-disulfide reductase DsbD | - |
M6G44_RS07060 (M6G44_07060) | 1525344..1525913 | + | 570 | WP_005608594.1 | elongation factor P hydroxylase | - |
M6G44_RS07065 (M6G44_07065) | 1525957..1526811 | - | 855 | WP_005615766.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15066.57 Da Isoelectric Point: 10.4054
>T245341 WP_005619674.1 NZ_CP097377:c1523341-1522970 [Actinobacillus pleuropneumoniae]
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|