Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YoeB-YefM |
| Location | 1436728..1437236 | Replicon | chromosome |
| Accession | NZ_CP097377 | ||
| Organism | Actinobacillus pleuropneumoniae strain GD2107 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M6G44_RS06595 | Protein ID | WP_017357690.1 |
| Coordinates | 1436976..1437236 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M6G44_RS06590 | Protein ID | WP_017357689.1 |
| Coordinates | 1436728..1436979 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G44_RS06550 (M6G44_06550) | 1432263..1432811 | - | 549 | WP_005617759.1 | type IV pilus biogenesis/stability protein PilW | - |
| M6G44_RS06555 (M6G44_06555) | 1432865..1434046 | - | 1182 | WP_005608495.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| M6G44_RS06580 (M6G44_06580) | 1434951..1436390 | + | 1440 | WP_005605060.1 | glutamate--tRNA ligase | - |
| M6G44_RS06590 (M6G44_06590) | 1436728..1436979 | + | 252 | WP_017357689.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| M6G44_RS06595 (M6G44_06595) | 1436976..1437236 | + | 261 | WP_017357690.1 | Txe/YoeB family addiction module toxin | Toxin |
| M6G44_RS06600 (M6G44_06600) | 1437395..1437562 | - | 168 | WP_005598320.1 | Trm112 family protein | - |
| M6G44_RS06605 (M6G44_06605) | 1437564..1438544 | - | 981 | WP_005598322.1 | tetraacyldisaccharide 4'-kinase | - |
| M6G44_RS06610 (M6G44_06610) | 1438638..1439897 | - | 1260 | WP_005598324.1 | ATP-dependent protease ATP-binding subunit ClpX | - |
| M6G44_RS06615 (M6G44_06615) | 1439897..1440487 | - | 591 | WP_005601821.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
| M6G44_RS06620 (M6G44_06620) | 1440609..1441001 | + | 393 | WP_005620423.1 | SufE family protein | - |
| M6G44_RS06635 (M6G44_06635) | 1441360..1442133 | - | 774 | WP_005618837.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1431165..1432088 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10423.94 Da Isoelectric Point: 8.0109
>T245340 WP_017357690.1 NZ_CP097377:1436976-1437236 [Actinobacillus pleuropneumoniae]
MKLTFSSNSWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKPEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
MKLTFSSNSWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKPEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|