Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 723288..723938 | Replicon | chromosome |
| Accession | NZ_CP097377 | ||
| Organism | Actinobacillus pleuropneumoniae strain GD2107 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | B0BNU3 |
| Locus tag | M6G44_RS03345 | Protein ID | WP_005614926.1 |
| Coordinates | 723288..723677 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | B0BNU4 |
| Locus tag | M6G44_RS03350 | Protein ID | WP_005604117.1 |
| Coordinates | 723678..723938 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G44_RS03330 (M6G44_03330) | 718937..720133 | + | 1197 | WP_012478414.1 | amino acid aminotransferase | - |
| M6G44_RS03335 (M6G44_03335) | 720237..721520 | - | 1284 | WP_005617151.1 | Xaa-Pro aminopeptidase | - |
| M6G44_RS03340 (M6G44_03340) | 721929..723152 | - | 1224 | WP_005617152.1 | ATP-binding protein | - |
| M6G44_RS03345 (M6G44_03345) | 723288..723677 | - | 390 | WP_005614926.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M6G44_RS03350 (M6G44_03350) | 723678..723938 | - | 261 | WP_005604117.1 | hypothetical protein | Antitoxin |
| M6G44_RS03355 (M6G44_03355) | 724072..726093 | - | 2022 | WP_005617154.1 | excinuclease ABC subunit UvrB | - |
| M6G44_RS03360 (M6G44_03360) | 726270..727082 | + | 813 | WP_005604121.1 | iron uptake system protein EfeO | - |
| M6G44_RS03365 (M6G44_03365) | 727094..728287 | + | 1194 | WP_237601177.1 | iron uptake transporter deferrochelatase/peroxidase subunit | - |
| M6G44_RS03370 (M6G44_03370) | 728298..728918 | + | 621 | WP_005596976.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14837.17 Da Isoelectric Point: 5.1295
>T245339 WP_005614926.1 NZ_CP097377:c723677-723288 [Actinobacillus pleuropneumoniae]
MYMLDTNTVSYFFRQDPTVVKKLQQLNPELICISSVTAAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQL
RAEMEREGKIMGVQDQMIGAHALATECVLVSSDKAFQFIPNLVLENWWK
MYMLDTNTVSYFFRQDPTVVKKLQQLNPELICISSVTAAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQL
RAEMEREGKIMGVQDQMIGAHALATECVLVSSDKAFQFIPNLVLENWWK
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|