Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4105480..4106314 | Replicon | chromosome |
| Accession | NZ_CP097370 | ||
| Organism | Escherichia coli strain AGR5151 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | M7748_RS19795 | Protein ID | WP_000854770.1 |
| Coordinates | 4105480..4105857 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | M7748_RS19800 | Protein ID | WP_001280950.1 |
| Coordinates | 4105946..4106314 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7748_RS19770 (4101591) | 4101591..4103213 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| M7748_RS24435 (4103875) | 4103875..4104180 | - | 306 | Protein_3879 | helix-turn-helix domain-containing protein | - |
| M7748_RS19780 (4104547) | 4104547..4104696 | - | 150 | Protein_3880 | hypothetical protein | - |
| M7748_RS19785 (4104802) | 4104802..4104978 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M7748_RS19790 (4104995) | 4104995..4105483 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M7748_RS19795 (4105480) | 4105480..4105857 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| M7748_RS19800 (4105946) | 4105946..4106314 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M7748_RS19805 (4106477) | 4106477..4106698 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| M7748_RS19810 (4106761) | 4106761..4107237 | - | 477 | WP_001186779.1 | RadC family protein | - |
| M7748_RS19815 (4107253) | 4107253..4107717 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| M7748_RS19820 (4108059) | 4108059..4108877 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| M7748_RS19825 (4108995) | 4108995..4109190 | - | 196 | Protein_3889 | DUF905 family protein | - |
| M7748_RS19830 (4109261) | 4109261..4111162 | - | 1902 | Protein_3890 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4095192..4134043 | 38851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T245331 WP_000854770.1 NZ_CP097370:c4105857-4105480 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT245331 WP_001280950.1 NZ_CP097370:c4106314-4105946 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |