Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3924913..3925463 Replicon chromosome
Accession NZ_CP097370
Organism Escherichia coli strain AGR5151

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M7748_RS18890 Protein ID WP_001160966.1
Coordinates 3924913..3925227 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag M7748_RS18895 Protein ID WP_000125566.1
Coordinates 3925230..3925463 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7748_RS18865 (3920588) 3920588..3921874 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M7748_RS18870 (3921874) 3921874..3922863 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M7748_RS18875 (3922860) 3922860..3923681 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M7748_RS18880 (3923684) 3923684..3924061 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M7748_RS18885 (3924068) 3924068..3924916 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M7748_RS18890 (3924913) 3924913..3925227 - 315 WP_001160966.1 CcdB family protein Toxin
M7748_RS18895 (3925230) 3925230..3925463 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M7748_RS18900 (3925549) 3925549..3926028 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M7748_RS18905 (3926220) 3926220..3928082 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
M7748_RS18910 (3928075) 3928075..3928605 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M7748_RS18915 (3928713) 3928713..3930044 - 1332 WP_001183207.1 MFS transporter -
M7748_RS18920 (3930103) 3930103..3930390 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T245329 WP_001160966.1 NZ_CP097370:c3925227-3924913 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT245329 WP_000125566.1 NZ_CP097370:c3925463-3925230 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References