Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3513185..3513803 | Replicon | chromosome |
| Accession | NZ_CP097370 | ||
| Organism | Escherichia coli strain AGR5151 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M7748_RS16950 | Protein ID | WP_001291435.1 |
| Coordinates | 3513585..3513803 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M7748_RS16945 | Protein ID | WP_000344800.1 |
| Coordinates | 3513185..3513559 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7748_RS16935 (3508274) | 3508274..3509467 | + | 1194 | WP_250024141.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M7748_RS16940 (3509490) | 3509490..3512639 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| M7748_RS16945 (3513185) | 3513185..3513559 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M7748_RS16950 (3513585) | 3513585..3513803 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M7748_RS16955 (3513976) | 3513976..3514527 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| M7748_RS16960 (3514643) | 3514643..3515113 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M7748_RS16965 (3515277) | 3515277..3516827 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M7748_RS16970 (3516869) | 3516869..3517222 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| M7748_RS16980 (3517601) | 3517601..3517912 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| M7748_RS16985 (3517943) | 3517943..3518515 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T245327 WP_001291435.1 NZ_CP097370:3513585-3513803 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT245327 WP_000344800.1 NZ_CP097370:3513185-3513559 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |