Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1957611..1958442 | Replicon | chromosome |
| Accession | NZ_CP097370 | ||
| Organism | Escherichia coli strain AGR5151 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | M7748_RS09185 | Protein ID | WP_000854814.1 |
| Coordinates | 1957611..1957985 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | M7748_RS09190 | Protein ID | WP_001546021.1 |
| Coordinates | 1958074..1958442 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7748_RS09150 (1953606) | 1953606..1953935 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| M7748_RS09155 (1954036) | 1954036..1954359 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| M7748_RS09160 (1954338) | 1954338..1954418 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| M7748_RS09165 (1954629) | 1954629..1956170 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M7748_RS09170 (1956185) | 1956185..1956931 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M7748_RS09175 (1957294) | 1957294..1957374 | - | 81 | Protein_1802 | hypothetical protein | - |
| M7748_RS09180 (1957420) | 1957420..1957614 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| M7748_RS09185 (1957611) | 1957611..1957985 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| M7748_RS09190 (1958074) | 1958074..1958442 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| M7748_RS09195 (1958522) | 1958522..1958743 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| M7748_RS09200 (1958806) | 1958806..1959282 | - | 477 | WP_001610726.1 | RadC family protein | - |
| M7748_RS09205 (1959298) | 1959298..1959771 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| M7748_RS09210 (1960034) | 1960034..1960855 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| M7748_RS09215 (1961076) | 1961076..1961486 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| M7748_RS09220 (1961502) | 1961502..1962179 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| M7748_RS09225 (1962315) | 1962315..1963385 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T245321 WP_000854814.1 NZ_CP097370:c1957985-1957611 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT245321 WP_001546021.1 NZ_CP097370:c1958442-1958074 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |