Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1957611..1958442 Replicon chromosome
Accession NZ_CP097370
Organism Escherichia coli strain AGR5151

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M7748_RS09185 Protein ID WP_000854814.1
Coordinates 1957611..1957985 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag M7748_RS09190 Protein ID WP_001546021.1
Coordinates 1958074..1958442 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7748_RS09150 (1953606) 1953606..1953935 + 330 WP_000450409.1 DUF496 family protein -
M7748_RS09155 (1954036) 1954036..1954359 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
M7748_RS09160 (1954338) 1954338..1954418 + 81 WP_023441679.1 hypothetical protein -
M7748_RS09165 (1954629) 1954629..1956170 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
M7748_RS09170 (1956185) 1956185..1956931 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
M7748_RS09175 (1957294) 1957294..1957374 - 81 Protein_1802 hypothetical protein -
M7748_RS09180 (1957420) 1957420..1957614 - 195 WP_000988601.1 DUF5983 family protein -
M7748_RS09185 (1957611) 1957611..1957985 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M7748_RS09190 (1958074) 1958074..1958442 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M7748_RS09195 (1958522) 1958522..1958743 - 222 WP_000692323.1 DUF987 domain-containing protein -
M7748_RS09200 (1958806) 1958806..1959282 - 477 WP_001610726.1 RadC family protein -
M7748_RS09205 (1959298) 1959298..1959771 - 474 WP_001385393.1 antirestriction protein -
M7748_RS09210 (1960034) 1960034..1960855 - 822 WP_001234710.1 DUF932 domain-containing protein -
M7748_RS09215 (1961076) 1961076..1961486 - 411 WP_000846704.1 hypothetical protein -
M7748_RS09220 (1961502) 1961502..1962179 - 678 WP_001362823.1 hypothetical protein -
M7748_RS09225 (1962315) 1962315..1963385 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T245321 WP_000854814.1 NZ_CP097370:c1957985-1957611 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT245321 WP_001546021.1 NZ_CP097370:c1958442-1958074 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References