Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 884086..884920 | Replicon | chromosome |
| Accession | NZ_CP097370 | ||
| Organism | Escherichia coli strain AGR5151 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | M7748_RS04260 | Protein ID | WP_001546109.1 |
| Coordinates | 884086..884463 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | M7748_RS04265 | Protein ID | WP_001546108.1 |
| Coordinates | 884540..884920 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7748_RS04230 (880480) | 880480..880650 | - | 171 | Protein_833 | IS110 family transposase | - |
| M7748_RS04235 (881067) | 881067..882001 | - | 935 | Protein_834 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M7748_RS04240 (881994) | 881994..882389 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| M7748_RS04245 (882458) | 882458..883303 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| M7748_RS04250 (883388) | 883388..883585 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| M7748_RS04255 (883602) | 883602..884089 | - | 488 | Protein_838 | DUF5983 family protein | - |
| M7748_RS04260 (884086) | 884086..884463 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| M7748_RS04265 (884540) | 884540..884920 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M7748_RS04270 (884970) | 884970..885614 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| M7748_RS04275 (885633) | 885633..885854 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M7748_RS04280 (885923) | 885923..886399 | - | 477 | WP_001424026.1 | RadC family protein | - |
| M7748_RS04285 (886415) | 886415..886900 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| M7748_RS04290 (886955) | 886955..887773 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| M7748_RS04295 (887873) | 887873..888106 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| M7748_RS04300 (888185) | 888185..888640 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T245318 WP_001546109.1 NZ_CP097370:c884463-884086 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT245318 WP_001546108.1 NZ_CP097370:c884920-884540 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|