Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 351883..352683 | Replicon | chromosome |
Accession | NZ_CP097370 | ||
Organism | Escherichia coli strain AGR5151 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | M7748_RS01620 | Protein ID | WP_000342452.1 |
Coordinates | 352156..352683 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | M7748_RS01615 | Protein ID | WP_001277107.1 |
Coordinates | 351883..352149 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7748_RS01595 (347542) | 347542..348210 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
M7748_RS01600 (348203) | 348203..349261 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
M7748_RS01605 (349506) | 349506..350360 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
M7748_RS01610 (350631) | 350631..351734 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
M7748_RS01615 (351883) | 351883..352149 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
M7748_RS01620 (352156) | 352156..352683 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
M7748_RS01625 (352680) | 352680..353063 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
M7748_RS01630 (353486) | 353486..354595 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
M7748_RS01635 (354643) | 354643..355569 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
M7748_RS01640 (355566) | 355566..356843 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
M7748_RS01645 (356840) | 356840..357607 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T245315 WP_000342452.1 NZ_CP097370:352156-352683 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |