Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 113779..114380 | Replicon | plasmid pAGR6128 |
Accession | NZ_CP097368 | ||
Organism | Escherichia coli strain AGR6128 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | M7747_RS24250 | Protein ID | WP_001216034.1 |
Coordinates | 114000..114380 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | M7747_RS24245 | Protein ID | WP_001190712.1 |
Coordinates | 113779..114000 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7747_RS24235 (110772) | 110772..112043 | - | 1272 | WP_023142242.1 | restriction endonuclease subunit S | - |
M7747_RS24240 (112040) | 112040..113596 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
M7747_RS24245 (113779) | 113779..114000 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M7747_RS24250 (114000) | 114000..114380 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M7747_RS24255 (114385) | 114385..114564 | + | 180 | WP_001513661.1 | hypothetical protein | - |
M7747_RS24260 (114592) | 114592..114870 | + | 279 | Protein_130 | pdcB | - |
M7747_RS24265 (114875) | 114875..115288 | + | 414 | Protein_131 | integrase core domain-containing protein | - |
M7747_RS24270 (115238) | 115238..115573 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
M7747_RS24275 (115783) | 115783..116763 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
M7747_RS24280 (117007) | 117007..118410 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
M7747_RS24285 (118397) | 118397..119329 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..122671 | 122671 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T245312 WP_001216034.1 NZ_CP097368:114000-114380 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |