Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 103322..103847 | Replicon | plasmid pAGR6128 |
| Accession | NZ_CP097368 | ||
| Organism | Escherichia coli strain AGR6128 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | M7747_RS24205 | Protein ID | WP_001159868.1 |
| Coordinates | 103322..103627 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | M7747_RS24210 | Protein ID | WP_000813634.1 |
| Coordinates | 103629..103847 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7747_RS24190 (99232) | 99232..100398 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| M7747_RS24195 (100986) | 100986..101741 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| M7747_RS24200 (102515) | 102515..103321 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| M7747_RS24205 (103322) | 103322..103627 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M7747_RS24210 (103629) | 103629..103847 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M7747_RS24215 (104555) | 104555..105550 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| M7747_RS24220 (105593) | 105593..106486 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..122671 | 122671 | |
| - | flank | IS/Tn | - | - | 106623..107126 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T245311 WP_001159868.1 NZ_CP097368:c103627-103322 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|