Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4122534..4123368 | Replicon | chromosome |
| Accession | NZ_CP097367 | ||
| Organism | Escherichia coli strain AGR6128 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | M7747_RS20120 | Protein ID | WP_000854770.1 |
| Coordinates | 4122534..4122911 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | M7747_RS20125 | Protein ID | WP_001280950.1 |
| Coordinates | 4123000..4123368 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7747_RS20095 (4118645) | 4118645..4120267 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| M7747_RS24380 (4120929) | 4120929..4121234 | - | 306 | Protein_3939 | helix-turn-helix domain-containing protein | - |
| M7747_RS20105 (4121601) | 4121601..4121750 | - | 150 | Protein_3940 | hypothetical protein | - |
| M7747_RS20110 (4121856) | 4121856..4122032 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M7747_RS20115 (4122049) | 4122049..4122537 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M7747_RS20120 (4122534) | 4122534..4122911 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| M7747_RS20125 (4123000) | 4123000..4123368 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M7747_RS20130 (4123531) | 4123531..4123752 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| M7747_RS20135 (4123815) | 4123815..4124291 | - | 477 | WP_001186779.1 | RadC family protein | - |
| M7747_RS20140 (4124307) | 4124307..4124771 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| M7747_RS20145 (4125113) | 4125113..4125931 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| M7747_RS20150 (4126049) | 4126049..4126244 | - | 196 | Protein_3949 | DUF905 family protein | - |
| M7747_RS20155 (4126315) | 4126315..4128216 | - | 1902 | Protein_3950 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4110888..4151097 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T245305 WP_000854770.1 NZ_CP097367:c4122911-4122534 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT245305 WP_001280950.1 NZ_CP097367:c4123368-4123000 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |