Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3564169..3564787 | Replicon | chromosome |
Accession | NZ_CP097367 | ||
Organism | Escherichia coli strain AGR6128 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M7747_RS17410 | Protein ID | WP_001291435.1 |
Coordinates | 3564569..3564787 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M7747_RS17405 | Protein ID | WP_000344800.1 |
Coordinates | 3564169..3564543 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7747_RS17395 (3559258) | 3559258..3560451 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M7747_RS17400 (3560474) | 3560474..3563623 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
M7747_RS17405 (3564169) | 3564169..3564543 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M7747_RS17410 (3564569) | 3564569..3564787 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M7747_RS17415 (3564960) | 3564960..3565511 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
M7747_RS17420 (3565627) | 3565627..3566097 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M7747_RS17425 (3566261) | 3566261..3567811 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M7747_RS17430 (3567853) | 3567853..3568206 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
M7747_RS17440 (3568585) | 3568585..3568896 | + | 312 | WP_000409908.1 | MGMT family protein | - |
M7747_RS17445 (3568927) | 3568927..3569499 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T245301 WP_001291435.1 NZ_CP097367:3564569-3564787 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT245301 WP_000344800.1 NZ_CP097367:3564169-3564543 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |