Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1964898..1965729 Replicon chromosome
Accession NZ_CP097367
Organism Escherichia coli strain AGR6128

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M7747_RS09325 Protein ID WP_000854814.1
Coordinates 1964898..1965272 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag M7747_RS09330 Protein ID WP_001546021.1
Coordinates 1965361..1965729 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7747_RS09290 (1960893) 1960893..1961222 + 330 WP_000450409.1 DUF496 family protein -
M7747_RS09295 (1961323) 1961323..1961646 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
M7747_RS09300 (1961625) 1961625..1961705 + 81 WP_023441679.1 hypothetical protein -
M7747_RS09305 (1961916) 1961916..1963457 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
M7747_RS09310 (1963472) 1963472..1964218 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
M7747_RS09315 (1964581) 1964581..1964661 - 81 Protein_1829 hypothetical protein -
M7747_RS09320 (1964707) 1964707..1964901 - 195 WP_000988601.1 DUF5983 family protein -
M7747_RS09325 (1964898) 1964898..1965272 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M7747_RS09330 (1965361) 1965361..1965729 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M7747_RS09335 (1965809) 1965809..1966030 - 222 WP_000692323.1 DUF987 domain-containing protein -
M7747_RS09340 (1966093) 1966093..1966569 - 477 WP_001610726.1 RadC family protein -
M7747_RS09345 (1966585) 1966585..1967058 - 474 WP_001385393.1 antirestriction protein -
M7747_RS09350 (1967321) 1967321..1968142 - 822 WP_001234710.1 DUF932 domain-containing protein -
M7747_RS09355 (1968363) 1968363..1968773 - 411 WP_000846704.1 hypothetical protein -
M7747_RS09360 (1968789) 1968789..1969466 - 678 WP_001362823.1 hypothetical protein -
M7747_RS09365 (1969602) 1969602..1970672 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T245294 WP_000854814.1 NZ_CP097367:c1965272-1964898 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT245294 WP_001546021.1 NZ_CP097367:c1965729-1965361 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References