Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1964898..1965729 | Replicon | chromosome |
| Accession | NZ_CP097367 | ||
| Organism | Escherichia coli strain AGR6128 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | M7747_RS09325 | Protein ID | WP_000854814.1 |
| Coordinates | 1964898..1965272 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | M7747_RS09330 | Protein ID | WP_001546021.1 |
| Coordinates | 1965361..1965729 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7747_RS09290 (1960893) | 1960893..1961222 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| M7747_RS09295 (1961323) | 1961323..1961646 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| M7747_RS09300 (1961625) | 1961625..1961705 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| M7747_RS09305 (1961916) | 1961916..1963457 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M7747_RS09310 (1963472) | 1963472..1964218 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M7747_RS09315 (1964581) | 1964581..1964661 | - | 81 | Protein_1829 | hypothetical protein | - |
| M7747_RS09320 (1964707) | 1964707..1964901 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| M7747_RS09325 (1964898) | 1964898..1965272 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| M7747_RS09330 (1965361) | 1965361..1965729 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| M7747_RS09335 (1965809) | 1965809..1966030 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| M7747_RS09340 (1966093) | 1966093..1966569 | - | 477 | WP_001610726.1 | RadC family protein | - |
| M7747_RS09345 (1966585) | 1966585..1967058 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| M7747_RS09350 (1967321) | 1967321..1968142 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| M7747_RS09355 (1968363) | 1968363..1968773 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| M7747_RS09360 (1968789) | 1968789..1969466 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| M7747_RS09365 (1969602) | 1969602..1970672 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T245294 WP_000854814.1 NZ_CP097367:c1965272-1964898 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT245294 WP_001546021.1 NZ_CP097367:c1965729-1965361 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |